Carbonic Anhydrase VB/CA5B Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Carbonic Anhydrase VB/CA5B Antibody [NBP1-86090] - Staining of human cell line HEK 293 shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: Carbonic Anhydrase VB/CA5B Antibody [NBP1-86090] -Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: Carbonic Anhydrase VB/CA5B Antibody [NBP1-86090] -Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: Carbonic Anhydrase VB/CA5B Antibody [NBP1-86090] - Staining of human rectum shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: Carbonic Anhydrase VB/CA5B Antibody [NBP1-86090] -Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.

Analysis in human cell line PC-3.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Carbonic Anhydrase VB/CA5B Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVD
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA5B
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Carbonic Anhydrase VB/CA5B Protein (NBP1-86090PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Carbonic Anhydrase VB/CA5B Antibody - BSA Free

• CA5B
• Carbonate dehydratase VB
• carbonic anhydrase 5B, mitochondrial
• Carbonic Anhydrase VB
• carbonic anhydrase VB, mitochondrial
• carbonic dehydratase
• CAVB
• CA-VB
• EC 4.2.1.1
• MGC39962

Background

Carbonic anhydrases (CAs) are members of a large family of zinc metalloenzymes responsible for catalyzing the reversible hydration of carbon dioxide.CAs show extensive diversity in their distribution and subcellular localization.They are involved in a variety of biological processes, including calcification, bone resorption, respiration, acid-base balance and the formation of aqueous humor, saliva, gastric juice and cerebrospinal fluid. CA VB, also known as carbonate dehydratase VB, is one of two isoforms of CA V. It localizes to the mitochondria and is involved in metabolic processes. CA VB is predominantly expressed in heart, pancreas, lung, placenta, kidney and skeletal muscle. It exhibits highest homology with family member CA VA (the second isoform of CA V); however, unlike CA VA, it is not expressed in the liver, suggesting that it plays a significantly different physiological role.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA5B