Recombinant Human SSBIP1/SOSS-C Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human SSBIP1/SOSS-C Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-104 of Human C9orf80 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE

Protein/Peptide Type
Recombinant Protein
Gene
INIP

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 150 mM NaCl, pH 7.5, 0.25 mM Dithiothreitol, 0.1 mM EGTA, 0.1 mM EDTA, 25% glycerol, 0.1 mM PMSF

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SSBIP1/SOSS-C Protein

  • chromosome 9 open reading frame 80
  • HSPC043
  • hSSB-interacting protein 1
  • hSSBIP1
  • minute INTS3/hSSB-associated element
  • MISE
  • Sensor of single-strand DNA complex subunit C
  • Sensor of ssDNA subunit C
  • Single-stranded DNA-binding protein-interacting protein 1
  • SOSS complex subunit C
  • SOSSC
  • SOSS-C
  • SSB-interacting protein 1
  • SSBIP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01578
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-19091
Species: Hu, Mu
Applications: WB, IP
NBP1-80720
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
H00023635-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-85740
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-16438
Species: Hu
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB100-79810
Species: Hu, Mu
Applications: WB, ICC/IF, IP, PLA
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00058493-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01) (0)

There are no publications for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01) (0)

There are no reviews for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SSBIP1/SOSS-C Products

Bioinformatics Tool for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01)

Discover related pathways, diseases and genes to SSBIP1/SOSS-C Recombinant Protein (H00058493-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01)

Discover more about diseases related to SSBIP1/SOSS-C Recombinant Protein (H00058493-P01).
 

Pathways for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01)

View related products by pathway.

PTMs for SSBIP1/SOSS-C Recombinant Protein (H00058493-P01)

Learn more about PTMs related to SSBIP1/SOSS-C Recombinant Protein (H00058493-P01).

Blogs on SSBIP1/SOSS-C

There are no specific blogs for SSBIP1/SOSS-C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SSBIP1/SOSS-C Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol INIP