SSBIP1/SOSS-C Antibody - BSA Free

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining in human thyroid gland and skeletal muscle tissues.. Corresponding INIP RNA-seq data are presented for the same tissues.

Western Blot: SSBIP1/SOSS-C Antibody [NBP1-81682] - Analysis in control (vector only transfected HEK293T lysate) and INIP over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunocytochemistry/Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP1-81682] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skin shows strong nuclear positivity in keratinocytes.

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.

Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human thyroid gland shows nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SSBIP1/SOSS-C Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
• Predicted Species: Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: INIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SSBIP1/SOSS-C Recombinant Protein Antigen (NBP1-81682PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SSBIP1/SOSS-C Antibody - BSA Free

• chromosome 9 open reading frame 80
• HSPC043
• hSSB-interacting protein 1
• hSSBIP1
• minute INTS3/hSSB-associated element
• MISE
• Sensor of single-strand DNA complex subunit C
• Sensor of ssDNA subunit C
• Single-stranded DNA-binding protein-interacting protein 1
• SOSS complex subunit C
• SOSSC
• SOSS-C
• SSB-interacting protein 1
• SSBIP1

Background

C9orf80 is a component of the SOSS complex, a multiprotein complex that functions downstream of the MRN complex to promoteDNA repair and G2/M checkpoint. The SOSS complex associates with single-stranded DNA at DNA lesions and influencesdiverse endpoints in the cellula

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: INIP