SSBIP1/SOSS-C Antibody


Western Blot: SSBIP1/SOSS-C Antibody [NBP1-81682] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate more
Immunocytochemistry/ Immunofluorescence: SSBIP1/SOSS-C Antibody [NBP1-81682] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human thyroid gland shows nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human duodenum shows moderate nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skin shows strong nuclear positivity in keratinocytes.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining in human thyroid gland and skeletal muscle tissues.. Corresponding INIP RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SSBIP1/SOSS-C Antibody [NBP1-81682] - Staining of human skeletal muscle shows no positivity in myocytes as expected.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

SSBIP1/SOSS-C Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: KEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHAHAHSSGYFITQDSAFGNL
Specificity of human SSBIP1/SOSS-C antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (94%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SSBIP1/SOSS-C Recombinant Protein Antigen (NBP1-81682PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SSBIP1/SOSS-C Antibody

  • chromosome 9 open reading frame 80
  • HSPC043
  • hSSB-interacting protein 1
  • hSSBIP1
  • minute INTS3/hSSB-associated element
  • MISE
  • Sensor of single-strand DNA complex subunit C
  • Sensor of ssDNA subunit C
  • Single-stranded DNA-binding protein-interacting protein 1
  • SOSS complex subunit C
  • SOSS-C
  • SSB-interacting protein 1
  • SSBIP1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SSBIP1/SOSS-C Antibody (NBP1-81682) (0)

There are no publications for SSBIP1/SOSS-C Antibody (NBP1-81682).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SSBIP1/SOSS-C Antibody (NBP1-81682) (0)

There are no reviews for SSBIP1/SOSS-C Antibody (NBP1-81682). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SSBIP1/SOSS-C Antibody (NBP1-81682) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for SSBIP1/SOSS-C Antibody (NBP1-81682)

Discover related pathways, diseases and genes to SSBIP1/SOSS-C Antibody (NBP1-81682). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SSBIP1/SOSS-C Antibody (NBP1-81682)

Discover more about diseases related to SSBIP1/SOSS-C Antibody (NBP1-81682).

Pathways for SSBIP1/SOSS-C Antibody (NBP1-81682)

View related products by pathway.

PTMs for SSBIP1/SOSS-C Antibody (NBP1-81682)

Learn more about PTMs related to SSBIP1/SOSS-C Antibody (NBP1-81682).

Blogs on SSBIP1/SOSS-C

There are no specific blogs for SSBIP1/SOSS-C, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SSBIP1/SOSS-C Antibody and receive a gift card or discount.


Gene Symbol INIP