SRD5A2 Antibody


Western Blot: SRD5A2 Antibody [NBP1-69492] - This Anti-SRD5A2 antibody was used in Western Blot of THP-1 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: SRD5A2 Antibody [NBP1-69492] - Monkey adrenal gland Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: more
Immunohistochemistry: SRD5A2 Antibody [NBP1-69492] - Monkey vagina Primary Antibody Dilution: 1 : 25 Secondary Antibody: Anti-rabbit-HRP Secondary Antibody Dilution: 1 : 1000 Color/Signal Descriptions: Brown: SRD5A2 more

Product Details

Reactivity Hu, MkSpecies Glossary
Applications WB, IHC

Order Details

SRD5A2 Antibody Summary

Synthetic peptides corresponding to SRD5A2(steroid-5-alpha-reductase, alpha polypeptide 2) The peptide sequence was selected from the N terminal of SRD5A2. Peptide sequence MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against SRD5A2 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SRD5A2 Antibody

  • 3-oxo-5-alpha-steroid 4-dehydrogenase 2,5 alpha-SR2
  • EC
  • MGC138457
  • S5AR 2
  • SR type 2
  • Steroid 5-alpha-reductase 2,3-oxo-5 alpha-steroid 4-dehydrogenase 2
  • steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta4-dehydrogenase alpha 2)
  • Type II 5-alpha reductase


This gene encodes a microsomal protein expressed at high levels in androgen-sensitive tissues such as the prostate. The encoded protein is active at acidic pH and is sensitive to the 4-azasteroid inhibitor finasteride. Deficiencies in this gene can result


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SRD5A2 Antibody (NBP1-69492) (0)

There are no publications for SRD5A2 Antibody (NBP1-69492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SRD5A2 Antibody (NBP1-69492) (0)

There are no reviews for SRD5A2 Antibody (NBP1-69492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SRD5A2 Antibody (NBP1-69492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SRD5A2 Products

Bioinformatics Tool for SRD5A2 Antibody (NBP1-69492)

Discover related pathways, diseases and genes to SRD5A2 Antibody (NBP1-69492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SRD5A2 Antibody (NBP1-69492)

Discover more about diseases related to SRD5A2 Antibody (NBP1-69492).

Pathways for SRD5A2 Antibody (NBP1-69492)

View related products by pathway.

PTMs for SRD5A2 Antibody (NBP1-69492)

Learn more about PTMs related to SRD5A2 Antibody (NBP1-69492).

Research Areas for SRD5A2 Antibody (NBP1-69492)

Find related products by research area.

Blogs on SRD5A2

There are no specific blogs for SRD5A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SRD5A2 Antibody and receive a gift card or discount.


Gene Symbol SRD5A2