SR-BI Antibody - BSA Free

Images

 
Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Staining of human adrenal gland shows high expression.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Analysis in human adrenal gland and pancreas tissues using Anti-SCARB1 antibody. Corresponding SCARB1 RNA-seq data are presented ...read more
Immunohistochemistry-Paraffin: SR-BI Antibody [NBP2-62676] - Staining of human pancreas shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
       

Orthogonal Strategies

 

Order Details

View Available Formulations
Catalog# & Formulation Size Price

SR-BI Antibody - BSA Free Summary

Immunogen
This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SCARB1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SR-BI Recombinant Protein Antigen (NBP2-62676PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SR-BI Antibody - BSA Free

  • CD36 and LIMPII analogous 1
  • CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 1
  • CD36 antigen
  • CD36L1
  • CD36L1scavenger receptor class B type 1
  • CLA1 CD36 antigen-like 1
  • CLA-1 HDLQTL6
  • CLA1
  • Collagen type I receptor, thrombospondin receptor-like 1
  • HDLQTL6
  • MGC138242
  • SCARB1
  • scavenger receptor class B type III
  • scavenger receptor class B, member 1
  • SRB1 scavenger receptor class B member 1
  • SR-B1
  • SRBI
  • SR-BI

Background

SR-BI (scavenger receptor class B member 1, SCARB1) belongs to the CD36 family and acts as a cell surface lipoprotein receptor for a variety of ligands including high density lipoprotein (HDL), phospholipids, phosphatidylserine, and lipoproteins such as lipopolysaccharide (LPS). SR-BI mediates selective uptake of HDL cholesteryl (HDL-C) ester in the liver, steroidogenic tissues, and adipose tissue and facilitates the flux of free and esterified cholesterol between the cell surface and apoB-containing lipoproteins and modified lipoproteins. SR-BI plays a role in antigen capture and cross-presentation from bacteria, parasites, and viruses such as Hepatitis C. In endothelial cells and macrophages, SR-BI is involved in anti-inflammatory and pro-survival signaling, providing protection against atherosclerosis and clearing apoptotic cells (efferocytosis) (1, 2).

At least 5 different human splice variants have been identified with theoretical molecular weights ranging from 60.9 kDa for the canonical sequence to 45 kDa for an N-terminally truncated variant (SR-BII) (3). The extracellular domain of human SR-BI (CLA-1) shares 80%, 80%, 89%, 86% and 84% aa sequence identity with mouse, rat, porcine, rabbit, and bovine SR-BI, respectively. SR-BI is highly glycosylated and removal of N-linked glycosylation reduces lipid transport.

References

1. Linton MF, Tao H, Linton EF, Yancey PG. (2017) SR-BI: A Multifunctional Receptor in Cholesterol Homeostasis and Atherosclerosis. Trends Endocrinol Metab. 28(6):461-472. PMID: 28259375

2. Hoekstra M, Sorci-Thomas M. (2017) Rediscovering scavenger receptor type BI: surprising new roles for the HDL receptor. Curr Opin Lipidol. 28(3):255-260. PMID: 28301373

3. Shen WJ, Asthana S, Kraemer FB, Azhar S. (2018) Scavenger receptor B type 1: expression, molecular regulation, and cholesterol transport function.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-144
Species: Av, Bv, Hu, Mu, Po, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-52979
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB400-105
Species: Ca, Ch, ChHa, Eq, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, ChIP, ChIP, Dual ISH-IHC, ELISA, Flow, GS, GS, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PCR, Simple Western, WB
NBP3-30941
Species: Hu, Rt
Applications: IHC, WB
AF2255
Species: Mu
Applications: Block, CyTOF-ready, Flow, IHC, WB
NB400-129
Species: Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB300-558
Species: Bv, Hu, Rb
Applications: ELISA, ICC/IF, IP, WB
NB400-132
Species: ChHa, Ha, Hu, Pm, Mu, Rb, Rt
Applications: Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, IP, In vitro, In vivo, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-00092
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, PLA, WB
NBP3-46020
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-62676
Species: Hu
Applications: IHC

Publications for SR-BI Antibody (NBP2-62676) (0)

There are no publications for SR-BI Antibody (NBP2-62676).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SR-BI Antibody (NBP2-62676) (0)

There are no reviews for SR-BI Antibody (NBP2-62676). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SR-BI Antibody (NBP2-62676) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SR-BI Products

Research Areas for SR-BI Antibody (NBP2-62676)

Find related products by research area.

Blogs on SR-BI.

ABCA1 (ATP-binding cassette transporter A1)
The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr...  Read full blog post.

ABCA1 - The Caretaker for Cholesterol Transportation
The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp...  Read full blog post.

Scavenger's Helper - SR-BI (scavenger receptor class B member 1, SCARB1)
SR-B1 belongs to the CD36 scavenger receptor family and serves as a receptor for several ligands including phospholipids, cholesterol ester, lipoproteins, phosphatidylserine, and caveolae localized HDL. It is expressed in endothelial cells, macrophage...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SR-BI Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol SCARB1