| Immunogen | This SR-BI Antibody was developed against a recombinant protein corresponding to amino acids: CYLFWSSSKKGSKDKEAIQAYSESLMTSAPKGSVLQEAKL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SCARB1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for SR-BI Antibody (NBP2-62676)Find related products by research area.
|
|
ABCA1 (ATP-binding cassette transporter A1) The ABCA1 molecule is a primary gatekeeper for regulating the intracellular transport of cholesterol. It belongs to a larger related multifamily of cAMP-dependent anion transporter cell membrane molecules. These key proteins are responsible for tr... Read full blog post. |
|
ABCA1 - The Caretaker for Cholesterol Transportation The ATP-binding cassette transporter A1 (ABCA1) protein is a key gatekeeper for regulating intracellular cholesterol transport. It is one member of a large family of genes comprised of cAMP-dependent anion transporter cell membrane proteins. These imp... Read full blog post. |
|
Scavenger's Helper - SR-BI (scavenger receptor class B member 1, SCARB1) SR-B1 belongs to the CD36 scavenger receptor family and serves as a receptor for several ligands including phospholipids, cholesterol ester, lipoproteins, phosphatidylserine, and caveolae localized HDL. It is expressed in endothelial cells, macrophage... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SCARB1 |