SPRY4 Antibody


Immunocytochemistry/ Immunofluorescence: SPRY4 Antibody [NBP2-68941] - Staining of human cell line SK-MEL-30 shows localization to the Golgi apparatus.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

SPRY4 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SSDQRLLDHMAPPPVADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACG
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Recommended conditions: Fixation/Permeabilization: PFA/Triton X-100
Control Peptide
SPRY4 Recombinant Protein Antigen (NBP2-68941PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Protein A purified

Alternate Names for SPRY4 Antibody

  • protein sprouty homolog 4
  • sprouty homolog 4 (Drosophila)
  • SPRY4
  • spry-4


Sprouty-4 (also known as SPRY4) is an inhibitor of the insulin receptor and EGFR-transduced mitogen-activated protein kinase (MAPK) signaling pathway downstream of FGF and EGF receptor tyrosine kinase activation. It is positioned upstream of RAS activation and impairs the formation of active GTP-RAS. SPRY4 is widely expressed, with different isoforms. The protein consists of 322 amino acids, with a cysteine-rich region, Src homology 3 binding regions, proline-rich regions, and a PEST sequence. It is expressed predominantly in the cytoplasm. Northern results show bands across most tissues, with strongest expression in heart, brain, placenta, lung, and intestine.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: BA
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA

Publications for SPRY4 Antibody (NBP2-68941) (0)

There are no publications for SPRY4 Antibody (NBP2-68941).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPRY4 Antibody (NBP2-68941) (0)

There are no reviews for SPRY4 Antibody (NBP2-68941). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPRY4 Antibody (NBP2-68941) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SPRY4 Products

Bioinformatics Tool for SPRY4 Antibody (NBP2-68941)

Discover related pathways, diseases and genes to SPRY4 Antibody (NBP2-68941). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPRY4 Antibody (NBP2-68941)

Discover more about diseases related to SPRY4 Antibody (NBP2-68941).

Pathways for SPRY4 Antibody (NBP2-68941)

View related products by pathway.

PTMs for SPRY4 Antibody (NBP2-68941)

Learn more about PTMs related to SPRY4 Antibody (NBP2-68941).

Research Areas for SPRY4 Antibody (NBP2-68941)

Find related products by research area.

Blogs on SPRY4

There are no specific blogs for SPRY4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SPRY4 Antibody and receive a gift card or discount.


Gene Symbol SPRY4