SPINK5 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Analysis in human tonsil and kidney tissues using Anti-SPINK5 antibody. Corresponding SPINK5 RNA-seq data are presented for the ...read more
Immunocytochemistry/ Immunofluorescence: SPINK5 Antibody [NBP1-90510] - Staining of human cell line HeLa shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human skin shows strong cytoplasmic positivity in squamous epithelial cells.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human kidney shows low expression as expected.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90510] - Staining of human uterine cervix shows moderate cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SPINK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DGRLGCTRENDPVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCTRESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQN
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPINK5 Protein (NBP1-90510PEP)
Publications
Read Publication using NBP1-90510.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK5 Antibody

  • Kazal type 5
  • LEKTI
  • LETKI
  • NETS
  • serine peptidase inhibitor, Kazal type 5
  • SPINK5
  • VAKTI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-20383
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-02623
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-26116
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
H00005555-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D6050
Species: Hu
Applications: ELISA
MAB7665
Species: Hu
Applications: IHC, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90927
Species: Hu
Applications: IHC, IHC-P, WB
DCRP00
Species: Hu
Applications: ELISA
AF4090
Species: Hu
Applications: IHC, IP, Neut, WB
AF3790
Species: Hu, Mu
Applications: ICC, Simple Western, WB
AF1067
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Neut, WB
NBP1-90510
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SPINK5 Antibody (NBP1-90510)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-90510 Applications Species
Gry M, Oksvold P, Ponten F et al. Tissue specific protein expression in human cells, tissues and organs. J Proteomics Bioinform 2010

Reviews for SPINK5 Antibody (NBP1-90510) (0)

There are no reviews for SPINK5 Antibody (NBP1-90510). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPINK5 Antibody (NBP1-90510) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK5 Products

Bioinformatics Tool for SPINK5 Antibody (NBP1-90510)

Discover related pathways, diseases and genes to SPINK5 Antibody (NBP1-90510). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK5 Antibody (NBP1-90510)

Discover more about diseases related to SPINK5 Antibody (NBP1-90510).
 

Pathways for SPINK5 Antibody (NBP1-90510)

View related products by pathway.

PTMs for SPINK5 Antibody (NBP1-90510)

Learn more about PTMs related to SPINK5 Antibody (NBP1-90510).
 

Research Areas for SPINK5 Antibody (NBP1-90510)

Find related products by research area.

Blogs on SPINK5

There are no specific blogs for SPINK5, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK5