SPINK5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SPINK5 Antibody [NBP1-90509] - Staining of human cell line HeLa shows localization to vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SPINK5 Antibody [NBP1-90509] - Staining of human esophagus shows strong cytoplasmic positivity in squamous epithelial cells(above basal layer).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPINK5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QQEERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEEEEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPINK5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPINK5 Protein (NBP1-90509PEP)
Publications
Read Publication using NBP1-90509.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPINK5 Antibody

  • Kazal type 5
  • LEKTI
  • LETKI
  • NETS
  • serine peptidase inhibitor, Kazal type 5
  • SPINK5
  • VAKTI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-30027
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-35213
Species: Hu
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4090
Species: Hu
Applications: WB, IHC, IP, Neut
NBP2-54602
Species: Vi
Applications: WB, ELISA, Flow, ICC/IF
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
NBP1-90509
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SPINK5 Antibody (NBP1-90509)(1)

Reviews for SPINK5 Antibody (NBP1-90509) (0)

There are no reviews for SPINK5 Antibody (NBP1-90509). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SPINK5 Antibody (NBP1-90509) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPINK5 Products

Bioinformatics Tool for SPINK5 Antibody (NBP1-90509)

Discover related pathways, diseases and genes to SPINK5 Antibody (NBP1-90509). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPINK5 Antibody (NBP1-90509)

Discover more about diseases related to SPINK5 Antibody (NBP1-90509).
 

Pathways for SPINK5 Antibody (NBP1-90509)

View related products by pathway.

PTMs for SPINK5 Antibody (NBP1-90509)

Learn more about PTMs related to SPINK5 Antibody (NBP1-90509).

Blogs on SPINK5

There are no specific blogs for SPINK5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPINK5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPINK5
Entrez