SPG21 Antibody

Images

 
Western Blot: SPG21 Antibody [NBP2-56164] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: SPG21 Antibody [NBP2-56164] - Staining of human cell line A549 shows localization to cytosol & vesicles.
Western Blot: SPG21 Antibody [NBP2-56164] - Analysis in human cell line A-549.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPG21 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: AKEEMYKLYPNARRAHLKTGGNFPYLCRSAEVNLYVQIHLLQFHGTKYAAIDPSMVSAEELEVQKGSLGISQEEQ
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPG21
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPG21 Recombinant Protein Antigen (NBP2-56164PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SPG21 Antibody

  • Acid cluster protein 33
  • ACP33Spastic paraplegia 21 protein
  • GL010
  • MASPARDIN
  • MASTBM-019
  • spastic paraplegia 21 (autosomal recessive, Mast syndrome)
  • Spastic paraplegia 21 autosomal recessive Mast syndrome protein

Background

SPG21 is encoded by this gene was identified by a two-hybrid screen using CD4 as the bait. It binds to the hydrophobic C-terminal amino acids of CD4 which are involved in repression of T cell activation. The interaction with CD4 is mediated by the noncatalytic alpha/beta hydrolase fold domain of this protein. It is thus proposed that this gene product modulates the stimulatory activity of CD4. At least three different transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00168400-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-88502
Species: Hu
Applications: IHC, IHC-P
DY1090
Species: Hu
Applications: ELISA
NBP1-76990
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
DY413
Species: Mu
Applications: ELISA
NBL1-14964
Species: Hu
Applications: WB
NBP2-01650
Species: Hu, Pm, Mu
Applications: Flow, IHC, IHC-P, WB
NBP1-86644
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76393
Species: Hu, Mu
Applications: CHIP-SEQ, Flow, ICC/IF, IHC, IHC-P, IP, WB
AF6386
Species: Hu
Applications: IP, WB
NBP1-86641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
H00002678-M01
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-86616
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-54724
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58917
Species: Hu
Applications: IHC, IHC-P, WB
2914-HT
Species: Hu
Applications: BA
NBP2-01860
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, WB
NBP1-47914
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-78039
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB

Publications for SPG21 Antibody (NBP2-56164) (0)

There are no publications for SPG21 Antibody (NBP2-56164).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPG21 Antibody (NBP2-56164) (0)

There are no reviews for SPG21 Antibody (NBP2-56164). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPG21 Antibody (NBP2-56164) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPG21 Products

Bioinformatics Tool for SPG21 Antibody (NBP2-56164)

Discover related pathways, diseases and genes to SPG21 Antibody (NBP2-56164). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPG21 Antibody (NBP2-56164)

Discover more about diseases related to SPG21 Antibody (NBP2-56164).
 

Pathways for SPG21 Antibody (NBP2-56164)

View related products by pathway.

Research Areas for SPG21 Antibody (NBP2-56164)

Find related products by research area.

Blogs on SPG21

There are no specific blogs for SPG21, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPG21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPG21