SPG21 Antibody

Images

 
Western Blot: SPG21 Antibody [NBP1-89273] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: SPG21 Antibody [NBP1-89273] - Staining of human gallbladder shows cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPG21 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AEYTHKSPRVHSLILCNSFSDTSIFNQTWTANSFWLMPAFMLKKIVLGNFSSGPVDPMMADAIDFMVDRLESLGQSELASRLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPG21
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SPG21 Protein (NBP1-89273PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPG21 Antibody

  • Acid cluster protein 33
  • ACP33Spastic paraplegia 21 protein
  • GL010
  • MASPARDIN
  • MASTBM-019
  • spastic paraplegia 21 (autosomal recessive, Mast syndrome)
  • Spastic paraplegia 21 autosomal recessive Mast syndrome protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00168400-D01P
Species: Hu
Applications: WB, ELISA
NBP1-82143
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-14964
Species: Hu
NBP2-01650
Species: Hu, Mu, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-86644
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56487
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ICC/IF, IP
AF6386
Species: Hu
Applications: WB, IP
NBP1-86641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-54724
Species: Hu
Applications: WB, IHC-P
NBP2-45897
Species: Hu
Applications: WB, IHC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-78039
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-CS
NBP1-89273
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPG21 Antibody (NBP1-89273) (0)

There are no publications for SPG21 Antibody (NBP1-89273).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SPG21 Antibody (NBP1-89273) (0)

There are no reviews for SPG21 Antibody (NBP1-89273). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPG21 Antibody (NBP1-89273) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPG21 Products

Bioinformatics Tool for SPG21 Antibody (NBP1-89273)

Discover related pathways, diseases and genes to SPG21 Antibody (NBP1-89273). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPG21 Antibody (NBP1-89273)

Discover more about diseases related to SPG21 Antibody (NBP1-89273).
 

Pathways for SPG21 Antibody (NBP1-89273)

View related products by pathway.

Research Areas for SPG21 Antibody (NBP1-89273)

Find related products by research area.

Blogs on SPG21

There are no specific blogs for SPG21, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPG21 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPG21