Spectrin beta 1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Spectrin beta 1 Antibody [NBP1-90350] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Spectrin beta 1 Antibody [NBP1-90350] - Staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Spectrin beta 1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFGHPQIEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPTB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Immunofluorescence
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Spectrin beta 1 Recombinant Protein Antigen (NBP1-90350PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Spectrin beta 1 Antibody

  • beta-I spectrin
  • EL3
  • erythrocyte
  • HS2
  • HSPTB1
  • membrane cytoskeletal protein
  • spectrin, beta, erythrocytic
  • SPTB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NB100-2070
Species: Hu
Applications: WB, Flow, IHC, IHC-P
AF5789
Species: Hu, Mu, Rt
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NBP1-80611
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82580
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
MAB17791
Species: Hu, Mu
Applications: WB
H00002035-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-84999
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-43557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37380
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB120-7164
Species: Hu, Mu, Rt, Fi
Applications: ELISA, ICC/IF, IHC-Fr, MiAr
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP1-90350
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF

Publications for Spectrin beta 1 Antibody (NBP1-90350) (0)

There are no publications for Spectrin beta 1 Antibody (NBP1-90350).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Spectrin beta 1 Antibody (NBP1-90350) (0)

There are no reviews for Spectrin beta 1 Antibody (NBP1-90350). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Spectrin beta 1 Antibody (NBP1-90350) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Spectrin beta 1 Products

Bioinformatics Tool for Spectrin beta 1 Antibody (NBP1-90350)

Discover related pathways, diseases and genes to Spectrin beta 1 Antibody (NBP1-90350). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Spectrin beta 1 Antibody (NBP1-90350)

Discover more about diseases related to Spectrin beta 1 Antibody (NBP1-90350).
 

Pathways for Spectrin beta 1 Antibody (NBP1-90350)

View related products by pathway.

PTMs for Spectrin beta 1 Antibody (NBP1-90350)

Learn more about PTMs related to Spectrin beta 1 Antibody (NBP1-90350).
 

Research Areas for Spectrin beta 1 Antibody (NBP1-90350)

Find related products by research area.

Blogs on Spectrin beta 1

There are no specific blogs for Spectrin beta 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Spectrin beta 1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPTB