Orthogonal Strategies: Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same ...read more
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YWHAB
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
The 14-3-3 proteins are a family of proteins involved in the regulation of apoptosis, mitogenic signaling and cell-cycle checkpoints. The 14-3-3 proteins are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. Through binding Bad, 14-3-3 prevents apoptosis by sequestering Bad to the cytosol.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for 14-3-3 beta/alpha Antibody (NBP1-80611) (0)
There are no reviews for 14-3-3 beta/alpha Antibody (NBP1-80611).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our 14-3-3 beta/alpha Antibody - BSA Free and receive a gift card or discount.