14-3-3 beta/alpha Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Analysis in human cerebral cortex and pancreas tissues. Corresponding YWHAB RNA-seq data are presented for the same ...read more
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cell line A-431 shows positivity in cytoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human pancreas shows very weak positivity in exocrine glandular cells as expected.
Western Blot: 14-3-3 beta/alpha Antibody [NBP1-80611] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human cerebellum shows moderate to strong cytoplasmic positivity in Purkinje cells.
Orthogonal Strategies: Immunohistochemistry-Paraffin: 14-3-3 beta/alpha Antibody [NBP1-80611] - Staining of human skin shows moderate to strong cytoplasmic positivity in epidermal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

14-3-3 beta/alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
YWHAB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
14-3-3 beta/alpha Protein (NBP1-80611PEP)
Publications
Read Publication using NBP1-80611.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for 14-3-3 beta/alpha Antibody

  • 14-3-3 alpha
  • 14-3-3 beta
  • 14-3-3 protein beta/alpha
  • brain protein 14-3-3, beta isoform
  • GW128
  • HS1
  • KCIP-1
  • Protein 1054
  • Protein kinase C inhibitor protein 1
  • protein kinase C inhibitor protein-1
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, alphapolypeptide
  • tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, betapolypeptide
  • YWHAA

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003059-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, PLA, S-ELISA, WB
NB300-574
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-82257
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27202
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-79772
Species: Hu
Applications: ELISA, IHC, IHC-P, PA, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-67632
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-14081
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84999
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-31647
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
MAB37861
Species: Hu
Applications: ICC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
MEP00B
Species: Mu
Applications: ELISA

Publications for 14-3-3 beta/alpha Antibody (NBP1-80611)(1)

Reviews for 14-3-3 beta/alpha Antibody (NBP1-80611) (0)

There are no reviews for 14-3-3 beta/alpha Antibody (NBP1-80611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for 14-3-3 beta/alpha Antibody (NBP1-80611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional 14-3-3 beta/alpha Products

Bioinformatics Tool for 14-3-3 beta/alpha Antibody (NBP1-80611)

Discover related pathways, diseases and genes to 14-3-3 beta/alpha Antibody (NBP1-80611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for 14-3-3 beta/alpha Antibody (NBP1-80611)

Discover more about diseases related to 14-3-3 beta/alpha Antibody (NBP1-80611).
 

Pathways for 14-3-3 beta/alpha Antibody (NBP1-80611)

View related products by pathway.

PTMs for 14-3-3 beta/alpha Antibody (NBP1-80611)

Learn more about PTMs related to 14-3-3 beta/alpha Antibody (NBP1-80611).
 

Research Areas for 14-3-3 beta/alpha Antibody (NBP1-80611)

Find related products by research area.

Blogs on 14-3-3 beta/alpha

There are no specific blogs for 14-3-3 beta/alpha, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our 14-3-3 beta/alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol YWHAB
Entrez
Uniprot