EPB41 Antibody (3D9)

Images

 
Western Blot: EPB41 Antibody (3D9) [H00002035-M01] - Analysis of EPB41 expression in transfected 293T cell line by EPB41 monoclonal antibody (M01), clone 3D9.Lane 1: EPB41 transfected lysate(81 KDa).Lane 2: ...read more
Immunocytochemistry/ Immunofluorescence: EPB41 Antibody (3D9) [H00002035-M01] - Analysis of monoclonal antibody to EPB41 on HeLa cell . Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: EPB41 Antibody (3D9) [H00002035-M01] - Analysis of monoclonal antibody to EPB41 on formalin-fixed paraffin-embedded human colon. Antibody concentration 3 ug/ml.
Sandwich ELISA: EPB41 Antibody (3D9) [H00002035-M01] - Detection limit for recombinant GST tagged EPB41 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC
Clone
3D9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

EPB41 Antibody (3D9) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
EPB41 (AAH39079, 116 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IEFGTSLDEEIILKAPIAAPEPELKTDPSLDLHSLSSAETQPAQEELREDPDFEIKEGEGLEECSKIEVKEESPQSKAETELKASQKPIRKHRNMHCKVSLLDDTVYECV
Specificity
EPB41 - erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
EPB41
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against transfected lysate for WB. It has been used for IHC-P, IF and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for EPB41 Antibody (3D9)

  • 4.1RBand 4.1
  • E41P
  • EL1
  • EPB4.1
  • erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked)
  • erythrocyte surface protein band 4.1
  • HE
  • P4.1
  • protein 4.1

Background

Elliptocytosis is a hematologic disorder characterized by elliptically shaped erythrocytes and a variable degree of hemolytic anemia. Inherited as an autosomal dominant, elliptocytosis results from mutation in any one of several genes encoding proteins of the red cell membrane skeleton. The form discussed here is the one found in the 1950s to be linked to Rh blood group and more recently shown to be caused by a defect in protein 4.1. 'Rh-unlinked' forms of elliptocytosis are caused by mutation in the alpha-spectrin gene (MIM 182860), the beta-spectrin gene (MIM 182870), or the band 3 gene (MIM 109270).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for EPB41 Antibody (H00002035-M01) (0)

There are no publications for EPB41 Antibody (H00002035-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for EPB41 Antibody (H00002035-M01) (0)

There are no reviews for EPB41 Antibody (H00002035-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for EPB41 Antibody (H00002035-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our EPB41 Antibody (3D9) and receive a gift card or discount.

Bioinformatics

Gene Symbol EPB41
Entrez
OMIM
Uniprot