ZW10 Antibody

Images

 
Independent Antibodies: Western Blot: ZW10 Antibody [NBP2-38644] - Analysis using Anti-ZW10 antibody NBP2-38644 (A) shows similar pattern to independent antibody NBP2-38751 (B).
Immunocytochemistry/ Immunofluorescence: ZW10 Antibody [NBP2-38644] - Staining of human cell line U-2 OS shows localization to cytosol & endoplasmic reticulum. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ZW10 Antibody [NBP2-38644] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

ZW10 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: TSTVPLAEMLGDMIWEDLSECLIKNCLVYSIPTNSSKLQQYEEIIQSTEEFENALKEMRFLKGDTTDLLKYARNINSHFANKKCQDVIVAARNLMTSE
Specificity
Specificity of human ZW10 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZW10
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZW10 Antibody

  • E3 ubiquitin-protein ligase ZSWIM2
  • EC 6.3.2.-
  • MEKK1-related protein X
  • MEX
  • MGC33890
  • Zinc finger SWIM domain-containing protein 2
  • zinc finger, SWIM domain containing 2
  • zinc finger, SWIM-type containing 2
  • ZZZ2ZZ-type zinc finger-containing protein 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP, ICC, IF
NBP2-21057
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00009735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-563
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-82312
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88626
Species: Hu
Applications: WB, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-52937
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-75424
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, MiAr
NBP1-85277
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-80645
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-338
Species: Hu, Ha
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP, PLA
NBP2-47517
Species: Hu
Applications: WB, IHC, IHC-P, KD
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP1-82875
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZW10 Antibody (NBP2-38644) (0)

There are no publications for ZW10 Antibody (NBP2-38644).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZW10 Antibody (NBP2-38644) (0)

There are no reviews for ZW10 Antibody (NBP2-38644). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZW10 Antibody (NBP2-38644) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ZW10 Products

Bioinformatics Tool for ZW10 Antibody (NBP2-38644)

Discover related pathways, diseases and genes to ZW10 Antibody (NBP2-38644). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZW10 Antibody (NBP2-38644)

Discover more about diseases related to ZW10 Antibody (NBP2-38644).
 

Pathways for ZW10 Antibody (NBP2-38644)

View related products by pathway.

PTMs for ZW10 Antibody (NBP2-38644)

Learn more about PTMs related to ZW10 Antibody (NBP2-38644).
 

Research Areas for ZW10 Antibody (NBP2-38644)

Find related products by research area.

Blogs on ZW10

There are no specific blogs for ZW10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZW10 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZW10
Uniprot