ZWINT Antibody

Images

 
Western Blot: ZWINT Antibody [NBP1-82868] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: ZWINT Antibody [NBP1-82868] - Staining of human cell line RH-30 shows localization to nucleoplasm, nuclear bodies & cytosol.
Immunohistochemistry-Paraffin: ZWINT Antibody [NBP1-82868] - Staining of human small intestine shows distinct cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ZWINT Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILVEFVVDSQKKDKLLCSQLQVADFLQNILAQEDTAKGLDPLASEDTSRQKAIAAKEQWKELKATYREHVEAIKIGLTKALTQMEEAQRKRTQLREAFEQLQAKKQMAMEKRRAVQNQWQLQQEKH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ZWINT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ZWINT Protein (NBP1-82868PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ZWINT Antibody

  • C20orf164
  • chromosome 20 open reading frame 164
  • dJ337O18.7
  • zinc finger SWIM domain-containing protein 3
  • zinc finger, SWIM domain containing 3
  • zinc finger, SWIM-type containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38644
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2359
Species: Hu
Applications: WB, IHC, IP
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-21057
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP1-82312
Species: Hu
Applications: WB, IHC, IHC-P
H00009735-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-91348
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB500-101
Species: Hu, Bv
Applications: WB, Flow, ICC/IF, IP
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85277
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
AF6817
Species: Hu
Applications: WB
NBP1-82868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ZWINT Antibody (NBP1-82868) (0)

There are no publications for ZWINT Antibody (NBP1-82868).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ZWINT Antibody (NBP1-82868) (0)

There are no reviews for ZWINT Antibody (NBP1-82868). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ZWINT Antibody (NBP1-82868) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ZWINT Products

Bioinformatics Tool for ZWINT Antibody (NBP1-82868)

Discover related pathways, diseases and genes to ZWINT Antibody (NBP1-82868). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ZWINT Antibody (NBP1-82868)

Discover more about diseases related to ZWINT Antibody (NBP1-82868).
 

Pathways for ZWINT Antibody (NBP1-82868)

View related products by pathway.

PTMs for ZWINT Antibody (NBP1-82868)

Learn more about PTMs related to ZWINT Antibody (NBP1-82868).
 

Research Areas for ZWINT Antibody (NBP1-82868)

Find related products by research area.

Blogs on ZWINT

There are no specific blogs for ZWINT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ZWINT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ZWINT