SPARC Antibody

Images

 
Independent Antibodies: Western Blot: SPARC Antibody [NBP1-80972] - Analysis using Anti-SPARC antibody NBP1-80972 (A) shows similar pattern to independent antibody NBP1-80971 (B).
Immunocytochemistry/ Immunofluorescence: SPARC Antibody [NBP1-80972] - Staining SPARC in MG63 cells using anti-SPARC antibody. Cell were fixed in 4% Paraformaldehyde (20 min, RT); and permeabilized in 0,2% Triton (15 ...read more
Immunohistochemistry-Paraffin: SPARC Antibody [NBP1-80972] - Staining of human placenta shows strong positivity in endothelial cells and fibroblasts.
Western Blot: SPARC Antibody [NBP1-80972] - Analysis of SPARC MC3T3 (mouse), MG63 (human) cell lysates and conditions media using anti-SPARC antibody. Image from verified customer review.
Orthogonal Strategies: Western Blot: SPARC Antibody [NBP1-80972] - Analysis in human cell lines U2OS and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPARC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDL
Specificity
Specificity of human, mouse SPARC antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPARC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Reviewed Applications
Read 2 Reviews rated 5
using
NBP1-80972 in the following applications:

Publications
Read Publication using NBP1-80972.

Reactivity Notes

Mouse reactivity per customer review.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPARC Antibody

  • Basement-membrane protein 40
  • BM-40
  • ONcysteine-rich protein
  • Osteonectin
  • Secreted protein acidic and rich in cysteine
  • secreted protein, acidic, cysteine-rich (osteonectin)
  • SPARC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ICC, Neut, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-91258
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Fe
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56630
Species: Hu
Applications: WB
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, GP
Applications: WB, Simple Western, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-77461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-80972
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SPARC Antibody (NBP1-80972)(1)

Reviews for SPARC Antibody (NBP1-80972) (2) 52

Average Rating: 5
(Based on 2 reviews)
We have 2 reviews tested in 1 species: Human.

Reviews using NBP1-80972:
Filter by Applications
ICC
(1)
WB
(1)
All Applications
Filter by Species
Human
(2)
All Species
Images Ratings Applications Species Date Details
Immunocytochemistry SPARC NBP1-80972
Enlarge
reviewed by:
Sandra Vieira
ICC Human 02/02/2015
View

Summary

ApplicationImmunocytochemistry
Sample TestedHuman osteosarcoma cells – MG63
SpeciesHuman
LotC8 3558

Blocking

Blocking DetailsPBS 3% BSA (30 min, RT)

Primary Anitbody

Dilution Ratioosteonectin –SPARC 1:200 in PBS 3% BSA (2h)

Secondary Antibody

Secondary Descriptionanti-rabbit alexa fluor 594
Secondary Concentration1:300

Details

Detection Notes4',6-diamidino-2-phenylindole (DAPI)-containing Vectashield antifading reagent, Olympus IX-81 inverted epifluorescence microscop
Fixation DetailsCell fixation: 4% Paraformaldehyde (20 min, RT); Cell permeabilization: 0,2% Triton (15 min, RT)
Wash DescriptionPBS, 5 min, 3 washes
Western Blot SPARC NBP1-80972
Enlarge
reviewed by:
Sandra Vieira
WB Human 02/02/2015
View

Summary

ApplicationWestern Blot
Sample TestedMG63 (human) cell lysates and conditioned media, MC3T3 (mouse) cell lysates and conditioned media
SpeciesHuman
LotC8 3558

Blocking

Blocking DetailsTBS-T 5% nonfat dry milk, 2h RT

Primary Anitbody

Dilution Ratio1:500 in TBS-T 3% nonfat dry milk, 1h RT + ON 4º

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgG, HRP
Secondary Concentration1:5000

Details

Detection NotesChemiluminescence detection (5 min)

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SPARC Antibody (NBP1-80972) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPARC Products

Bioinformatics Tool for SPARC Antibody (NBP1-80972)

Discover related pathways, diseases and genes to SPARC Antibody (NBP1-80972). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPARC Antibody (NBP1-80972)

Discover more about diseases related to SPARC Antibody (NBP1-80972).
 

Pathways for SPARC Antibody (NBP1-80972)

View related products by pathway.

PTMs for SPARC Antibody (NBP1-80972)

Learn more about PTMs related to SPARC Antibody (NBP1-80972).
 

Research Areas for SPARC Antibody (NBP1-80972)

Find related products by research area.

Blogs on SPARC.

Caspase 8 - a key mediator of apoptosis
Programmed cell death via apoptosis is a key controlled physiological process instigated by the cell death receptor family, their ligands, and the caspase cysteine protease family. All caspases exist in a precursor form that contains a prodomain, a...  Read full blog post.

GAPDH: More than a housekeeping gene
GAPDH is a 146kD tetramer glycolytic pathway metabolic enzyme composed of four 30-40 kDa subunits. It is responsible for reversibly phosphorylating its substrate glyceraldehyde 3-phosphate within the glycolytic pathway.  Apart from its role in gl...  Read full blog post.

GAPDH (Glyceraldehyde 3-Phosphate Dehydrogenase)
GAPDH is a 146 kD tetramer glycolytic pathway metabolic enzyme responsible for reversibly phosphorylating glyceraldehyde 3-phosphate. It may have other possible functions in transcriptional activation. GAPDH is highly expressed due to this housekeepin...  Read full blog post.

FLICE, FLICE, baby
Cell death via apoptosis is a fundamental cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. All caspases exist in a precursor form compose...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
2
4
0
3
0
2
0
1
0

Sandra Vieira
02/02/2015
Application: ICC
Species: Human

Sandra Vieira
02/02/2015
Application: WB
Species: Human

Bioinformatics

Gene Symbol SPARC
Entrez
Uniprot