SPARC Antibody

Images

 
Western Blot: SPARC Antibody [NBP1-80971] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: SPARC Antibody [NBP1-80971] - Staining of human placenta shows strong positivity in endothelial cells and fibroblasts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-Fr, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SPARC Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SPARC
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Frozen 1:100-1:2000
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry-Frozen reported in scientific literature (PMID 24552219)
Control Peptide
SPARC Protein (NBP1-80971PEP)
Publications
Read Publications using
NBP1-80971 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SPARC Antibody

  • Basement-membrane protein 40
  • BM-40
  • ONcysteine-rich protein
  • Osteonectin
  • Secreted protein acidic and rich in cysteine
  • secreted protein, acidic, cysteine-rich (osteonectin)
  • SPARC

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56630
Species: Hu
Applications: WB
AF2728
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-42378
Species: Hu
Applications: WB, IHC
NBP1-89134
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu
Applications: WB, IHC, IP
NBP1-80971
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for SPARC Antibody (NBP1-80971)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC-Fr, WB.


Filter By Application
IHC-Fr
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SPARC Antibody (NBP1-80971) (0)

There are no reviews for SPARC Antibody (NBP1-80971). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SPARC Antibody (NBP1-80971) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SPARC Products

Bioinformatics Tool for SPARC Antibody (NBP1-80971)

Discover related pathways, diseases and genes to SPARC Antibody (NBP1-80971). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SPARC Antibody (NBP1-80971)

Discover more about diseases related to SPARC Antibody (NBP1-80971).
 

Pathways for SPARC Antibody (NBP1-80971)

View related products by pathway.

PTMs for SPARC Antibody (NBP1-80971)

Learn more about PTMs related to SPARC Antibody (NBP1-80971).
 

Research Areas for SPARC Antibody (NBP1-80971)

Find related products by research area.

Blogs on SPARC.

Caspase 8 - a key mediator of apoptosis
Programmed cell death via apoptosis is a key controlled physiological process instigated by the cell death receptor family, their ligands, and the caspase cysteine protease family. All caspases exist in a precursor form that contains a prodomain, a...  Read full blog post.

GAPDH: More than a housekeeping gene
GAPDH is a 146kD tetramer glycolytic pathway metabolic enzyme composed of four 30-40 kDa subunits. It is responsible for reversibly phosphorylating its substrate glyceraldehyde 3-phosphate within the glycolytic pathway.  Apart from its role in gl...  Read full blog post.

GAPDH (Glyceraldehyde 3-Phosphate Dehydrogenase)
GAPDH is a 146 kD tetramer glycolytic pathway metabolic enzyme responsible for reversibly phosphorylating glyceraldehyde 3-phosphate. It may have other possible functions in transcriptional activation. GAPDH is highly expressed due to this housekeepin...  Read full blog post.

FLICE, FLICE, baby
Cell death via apoptosis is a fundamental cellular function triggered by the cell death receptor family and their ligands which signal through downstream adaptor molecules and the caspase protease family. All caspases exist in a precursor form compose...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SPARC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SPARC
Entrez
Uniprot