SOX4 Antibody

Images

 
Western Blot: SOX4 Antibody [H00006659-A01] - WB analysis of 36.23 kDa SOX4 partial recombinant protein (NP_003098, 45 a.a. ~ 136 a.a) with GST tag using mouse polyclonal SOX4 antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

SOX4 Antibody Summary

Immunogen
SOX4 (NP_003098, 45 a.a. - 136 a.a.) partial recombinant protein with GST tag. KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS
Specificity
SOX4 - SRY (sex determining region Y)-box 4
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
SOX4
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500
Publications
Read Publication using H00006659-A01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
50 % glycerol
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SOX4 Antibody

  • ecotropic viral integration site 16
  • EVI16
  • SRY (sex determining region Y)-box 4
  • SRY-related HMG-box gene 4
  • transcription factor SOX-4

Background

This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins, such as syndecan binding protein (syntenin). The protein may function in the apoptosis pathway leading to cell death as well as to tumorigenesis and may mediate downstream effects of parathyroid hormone (PTH) and PTH-related protein (PTHrP) in bone development. The solution structure has been resolved for the HMG-box of a similar mouse protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85823
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
AF4070
Species: Hu
Applications: WB, ICC
AF5286
Species: Hu
Applications: WB
H00006666-B01P
Species: Hu, Mu
Applications: WB
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1924
Species: Hu
Applications: WB, Simple Western, ChIP, ICC
H00051176-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, PLA, RNAi, S-ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-80306
Species: Hu, Av
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00006934-M06
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00006932-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
H00006659-A01
Species: Hu
Applications: WB, ELISA

Publications for SOX4 Antibody (H00006659-A01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for SOX4 Antibody (H00006659-A01) (0)

There are no reviews for SOX4 Antibody (H00006659-A01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOX4 Antibody (H00006659-A01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SOX4 Products

Bioinformatics Tool for SOX4 Antibody (H00006659-A01)

Discover related pathways, diseases and genes to SOX4 Antibody (H00006659-A01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX4 Antibody (H00006659-A01)

Discover more about diseases related to SOX4 Antibody (H00006659-A01).
 

Pathways for SOX4 Antibody (H00006659-A01)

View related products by pathway.

PTMs for SOX4 Antibody (H00006659-A01)

Learn more about PTMs related to SOX4 Antibody (H00006659-A01).
 

Research Areas for SOX4 Antibody (H00006659-A01)

Find related products by research area.

Blogs on SOX4.

Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling
By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX4
Entrez
OMIM
Uniprot