Reactivity | HuSpecies Glossary |
Applications | WB, ELISA |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | SOX4 (NP_003098, 45 a.a. - 136 a.a.) partial recombinant protein with GST tag. KADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIREAERLRLKHMADYPDYKYRPRKKVKS |
Specificity | SOX4 - SRY (sex determining region Y)-box 4 |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | SOX4 |
Purity | Unpurified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | The quality control of this antibody is limited to WB on the immunizing protein. It has been used for ELISA. Abnova's recommended working dilutions for western analysis are as follows: 1:500 dilution for ascites 1:1000 for purified Ig 1:500 |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | 50 % glycerol |
Preservative | No Preservative |
Purity | Unpurified |
Publication using H00006659-A01 | Applications | Species |
---|---|---|
Grau L, Luque-Garcia JL, Gonzalez-Peramato P et al. A quantitative proteomic analysis uncovers the relevance of CUL3 in bladder cancer aggressiveness. PLoS One. 2013-01-01 [PMID: 23308193] (Human) | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for SOX4 Antibody (H00006659-A01)Discover more about diseases related to SOX4 Antibody (H00006659-A01).
| Pathways for SOX4 Antibody (H00006659-A01)View related products by pathway.
|
PTMs for SOX4 Antibody (H00006659-A01)Learn more about PTMs related to SOX4 Antibody (H00006659-A01).
| Research Areas for SOX4 Antibody (H00006659-A01)Find related products by research area.
|
Bad news for stomach cancer: BAMBI protein inhibits gastric carcinoma via TGF-beta/epithelial-mesenchymal transition signaling By Jamshed Arslan Pharm.D. Gastric carcinoma is the second leading cause of cancer-related deaths worldwide. One of the key features of gastric carcinoma is acidosis, which promotes growth and metastasis of gastric ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.