Home » SOX11 » SOX11 Antibodies » SOX11 Antibody

SOX11 Antibody

 (20 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SOX11 Antibody [NBP1-85823] - Analysis in human cell line SH-SY5Y.
Western Blot: SOX11 Antibody [NBP1-85823] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SOX11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Specificity
Specificity of human SOX11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC, ChIP, WB reported in scientific literature (PMID: 24681958). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SOX11 Protein (NBP1-85823PEP)
Publications
Read Publications using
NBP1-85823 in the following applications:

  • ChIP
    1 publication
  • IHC
    4 publications
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 24681958).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX11 Antibody

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SOX4 Antibody
(CL5634)
NBP2-61420
Immunocytochemistry/Immunofluorescence: SOX4 Antibody (CL5634) [NBP2-61420] - Staining of SH-SY5Y cells using the Anti-SOX4 monoclonal antibody, showing specific staining in the nucleoplasm in green. Microtubule and nuclear probes are visualized in red and blue, respectively (where available). Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SOX4 Antibody (CL5634) [NBP2-61420] - Staining of rat hippocampus shows strong nuclear immunoreactivity in a subset of cells in the granule cell layer of the dentate gyrus.
Immunohistochemistry-Paraffin: SOX4 Antibody (CL5634) [NBP2-61420] - Staining of human glioma shows moderate to strong nuclear positivity in tumor cells.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - HELLS expression and protein levels are modulated with YAP1/TEAD inhibition downstream of SHH signaling. Western blot showing protein levels of HELLS, cleaved caspase 3 (CC3), and Cyclin D1 in verteporfin treated CGNPs. Blot is representative of three replicates. Full-length blots are presented in Supplementary Fig. S4. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-019-50088-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Cyclin D1 Antibody (SPM587) [NBP2-32840] - Formalin-paraffin human Mantle Cell Lymphoma stained with Cyclin D1 Ab (Clone SPM587).
Western Blot: Cyclin D1 Antibody (SPM587) [NBP2-32840] - analysis of Cyclin D1 in human breast cancer cell line MDA-MB-231 cell lysate using anti-Cyclin D1. Image from verified customer review.
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
SOX2 Antibody
(245610) [Unconjugate
MAB2018
Simple Western lane view shows lysates of BG01V human embryonic stem cells, loaded at 0.2 mg/mL. A specific band was detected for SOX2 at approximately 50 kDa (as indicated) using 4 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows lysates of NTera‑2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, D3 mouse embryonic stem cell line, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
E‑Cadherin and SOX2 were detected in BG01V human embryonic stem cells using 10 µg/mL Goat Anti-Human E‑Cadherin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF648) and 10 µg/mL Mouse Anti-Human/Mouse/Rat SOX2 Monoclonal Antibody (Catalog # MAB2018). Cells were incubated with primary antibodies for 3 hours at room temperature. Cells were stained for E‑Cadherin using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and for SOX2 using the NorthernLights 493-conjugated Anti-Mouse Secondary Antibody (green; Catalog # NL009). Cells were counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(12 Reviews)
(121 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
SOX9 Antibody
[Unconjugated]
AF3075
SOX9 was detected in immersion fixed BG01V human embryonic stem cells differentiated into early proximal lung progenitor cells using Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, KATO‑III human gastric carcinoma cell line, COLO 205 human colorectal adenocarcinoma cell line, and Hep3B human hepatocellular carcinoma cell line. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX9 at approximately 75 kDa (as indicated). GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX9 was detected in immersion fixed HEK293 human embryonic kidney cell line using 10 µg/mL Human SOX9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3075) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(6 Reviews)
(42 Publications)
Species: Hu
Applications: WB, Simple Western, ICC
SOX3 Antibody
AF2569
SOX3 was detected in immersion fixed NTera‑2 human testicular embryonic carcinoma cell line differentiation with retinoic acid using Goat Anti-Human SOX3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2569) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 493-conjugated Anti-Goat IgG Secondary Antibody (green, upper panel; Catalog # NL003) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(3 Publications)
Species: Hu
Applications: WB, ICC
SRY Antibody (1G4)
NBP2-37463
Western Blot: SRY Antibody (1G4) [NBP2-37463] - Analysis using SRY mouse mAb against NTERA-2 (1) cell lysate.
Immunohistochemistry-Paraffin: SRY Antibody (1G4) [NBP2-37463] - Analysis of ovarian cancer tissues using SRY mouse mAb with DAB staining.
Flow Cytometry: SRY Antibody (1G4) [NBP2-37463] - Analysis of HepG2 cells using SRY mouse mAb (green) and negative control (red).
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
SOX15 Antibody
[Unconjugated]
AF4070
Western blot shows lysates of JEG‑3 human epithelial choriocarcinoma cell line and BG01V human embryonic stem cells. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human SOX15 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4070) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SOX15 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX15 was detected in immersion fixed human plasmid-derived induced pluripotent stem cells (iPSK3) using Sheep Anti-Human SOX15 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4070) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Stem Cells on Coverslips.
(1 Publication)
Species: Hu
Applications: WB, ICC
SOX22 Antibody
H00006666-B01P
Western Blot: SOX22 Antibody [H00006666-B01P] - Analysis of SOX12 expression in transfected 293T cell line by SOX12 polyclonal antibody. Lane1:SOX12 transfected lysate(34.65 KDa). Lane2:Non-transfected lysate.
(1 Publication)
Species: Hu, Mu
Applications: WB
Fumarase Antibody
NBP1-31336
Western Blot: Fumarase Antibody [NBP1-31336] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Fumarate hydratase antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Fumarase Antibody [NBP1-31336] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: Fumarate hydratase protein stained by Fumarate hydratase antibody diluted at 1:500.Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Fumarase Antibody [NBP1-31336] - Analysis of paraffin-embedded NCIN87 xenograft, using fumarate hydratase antibody at 1:500 dilution.
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
CLEC4D/CLECSF8
Antibody (413512)
MAB2806
Human whole blood monocytes were stained with Mouse Anti-Human CLEC4D/CLECSF8 Monoclonal Antibody (Catalog # MAB2806, filled histogram) or isotype control antibody (Catalog # MAB0041, open histogram), followed by Phycoerythrin-conjugated Anti-Mouse IgG F(ab')2 Secondary Antibody (Catalog # F0102B).
(2 Publications)
Species: Hu
Applications: WB, Flow, CyTOF-ready
SOX10 Antibody
[Unconjugated]
AF2864
SOX10 was detected in immersion fixed BG01V human embryonic stem cells differentiated to neural crest stem cells using Goat Anti-Human SOX10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2864) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(27 Publications)
Species: Hu
Applications: WB, ICC
p53 Antibody (PAb
240)
NB200-103
Western Blot: p53 Antibody (PAb 240) [NB200-103] - Analysis of p53 in MCF7 and HeLa lystates. Image courtesy of anonymous customer product review.
Immunocytochemistry/Immunofluorescence: p53 Antibody (PAb 240) [NB200-103] - PC12 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.5% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-p53 Antibody (PAb 240) NB200-103 at 2 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: p53 Antibody (PAb 240) [NB200-103] - p53 was detected in immersion fixed paraffin-embedded sections of human prostate cancer using anti-human mouse monoclonal antibody (Catalog # NB200-103) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
(3 Reviews)
(28 Publications)
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
TEAD2 Antibody
NBP1-36953
Western Blot: TEAD2 Antibody [NBP1-36953] - Staining of Human Ileum lysate (35ug protein in RIPA buffer). Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Publication)
Species: Hu
Applications: WB, PEP-ELISA
SOX5 Antibody
AF5286
Western blot shows lysates of human lung tissue and exponentially growing LNCaP human prostate cancer cell line whole cell extract. PVDF membrane was probed with 1 µg/mL of Human SOX5 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5286) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for SOX5 at approximately 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB
POU3F3 Antibody
NBP1-49872
Western Blot: POU3F3 Antibody [NBP1-49872] - Analysis of POU3F3 in Mouse Spinal Cord lysate (35ug protein in RIPA buffer) using this antibody at 1 ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
(1 Review)
(4 Publications)
Species: Mu
Applications: WB, IHC, IHC-Fr, PEP-ELISA
SOX21 Antibody
(CL4688)
NBP2-59059
Western Blot: SOX21 Antibody (CL4688) [NBP2-59059] - Analysis in human cell line NTERA-2.
Immunocytochemistry/Immunofluorescence: SOX21 Antibody (CL4688) [NBP2-59059] - Staining of PC-3 cells using the Anti-SOX21 monoclonal antibody, showing specific staining in the nucleus in green. Microtubule- and nuclear probes are visualized in red and blue, respectively (where available).
Immunohistochemistry-Paraffin: SOX21 Antibody (CL4688) [NBP2-59059] - Staining of human fallopian tube shows no positivity as expected (negative control).
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
ATF3 Antibody
NBP1-85816
Knockout Validated: ATF3 Antibody [NBP1-85816] - HeLa human cervical epithelial carcinoma parental cell line lysate and ATF3 knockout (KO) HeLa cell line. PVDF membrane was probed with 0.1 ug/mL of Rabbit Anti-Human ATF3 Polyclonal Antibody (Catalog # NBP1-85816) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for ATF3 at approximately 22 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: ATF3 Antibody [NBP1-85816] - Usp9X inhibition causes Noxa increase and ER stress in MPNST cell lines. Ultrastructural analysis shows features of paraptosis. ST88-14 cells were transfected for 24 h with either non-targeting (NT)-siRNA or Usp9X-siRNA. Whole cell extracts were collected prior to Western blot analysis for ATF3, Noxa and beta-actin. Numbers shows protein quantification analyzed through ImageJ. N = 3. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-35806-5), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: ATF3 Antibody [NBP1-85816] - Staining of human cell line A-431 shows localization to nucleus and nucleoli. Antibody staining is shown in green.
(2 Reviews)
(11 Publications)
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
SOX8 Antibody
NBP2-54978
Immunocytochemistry/Immunofluorescence: SOX8 Antibody [NBP2-54978] - Staining of human cell line RH-30 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SOX8 Antibody [NBP2-54978] - Staining in human cerebral cortex and liver tissues using anti-SOX8 antibody. Corresponding SOX8 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: SOX8 Antibody [NBP2-54978] - Staining of human cerebral cortex shows high expression.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
SOX1 Antibody
[Unconjugated]
AF3369
Western blot shows lysates of undifferentiated iBJ6 human iPS cells and iBJ6 human iPS cells differentiated into neuroprogenitor cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3369) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for SOX1 at approximately 39 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of undifferentiated iBJ6 human iPS cells andiBJ6 human iPS cells differentiated into neuroprogenitor cells, loaded at 0.2 mg/mL. A specific band was detected for SOX1 at approximately 50 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat SOX1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3369) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
SOX1 was detected in immersion fixed rat cortical stem cells (Catalog # NSC001) using Goat Anti-Human/Mouse/Rat SOX1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3369) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(4 Reviews)
(36 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
SOX11 Antibody
NBP1-85823
SOX11 Antibody
Species: Hu
Applications: WB, ChIP, IHC, IHC-P

Publications for SOX11 Antibody (NBP1-85823)(20)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ChIP, IHC, WB.


Filter By Application
ChIP
(1)
IHC
(4)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 10 of 20. Show All 20 Publications.
Publications using NBP1-85823 Applications Species
Righi S, Pileri S, Agostinelli C et al. Reproducibility of SOX-11 detection in decalcified bone marrow tissue in mantle cell lymphoma patients. Hum. Pathol. Oct 5 2016 [PMID: 27720733] (IHC) IHC
Inmaculada Ribera-Cortada, Daniel Martinez, Virginia Amador et al. Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype. Modern Pathology 2015 Sep 11 [PMID: 26360498] (IHC, Human) IHC Human
Davidson B, Holth A, Hellesylt E et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol 2015 Jan [PMID: 25455994] (IHC, Human) IHC Human
Kuo PY, Leshchenko VV, Fazzari MJ et al. High resolution Chromatin Immunoprecipitation (Chromatin Immunoprecipitation) sequencing reveals novel bindings targets and prognostic role for SOX11 in Mantle cell lymphoma. Oncogene 2015 Mar 5 [PMID: 24681958] (IHC, ChIP, WB, Human) IHC, ChIP, WB Human
Nygren L, Baumgartner Wennerholm S, Klimkowska M et al. Prognostic role of SOX11 in a population-based cohort of mantle cell lymphoma. Blood 2012 May [PMID: 22431568]
Carvajal-Cuenca A, Sua LF, Silva NM et al. In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behavior. Haematologica 2012 Feb [PMID: 22058203]
Sernbo S, Gustavsson E, Brennan DJ et al. The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylation. BMC Cancer 2011 Sep [PMID: 21943380]
Kimura Y, Sato K, Imamura Y et al. Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 index. Cancer Sci 2011 Sep [PMID: 21609366]
Ondrejka SL, Lai R, Smith SD et al. Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosis. Haematologica 2011 Aug [PMID: 21508124]
Cao X, Fan L, Fang C et al. The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases. Med Oncol 2012 Jun [PMID: 21479697]
Show All 20 Publications.

Reviews for SOX11 Antibody (NBP1-85823) (0)

There are no reviews for SOX11 Antibody (NBP1-85823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for SOX11 Antibody (NBP1-85823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SOX11 Products

Bioinformatics Tool for SOX11 Antibody (NBP1-85823)

Discover related pathways, diseases and genes to SOX11 Antibody (NBP1-85823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX11 Antibody (NBP1-85823)

Discover more about diseases related to SOX11 Antibody (NBP1-85823).
 

Pathways for SOX11 Antibody (NBP1-85823)

View related products by pathway.

PTMs for SOX11 Antibody (NBP1-85823)

Learn more about PTMs related to SOX11 Antibody (NBP1-85823).

Blogs on SOX11.

Check out the latest blog posts on SOX11.
SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX11 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol SOX11