SOX11 Antibody

Images

 
Western Blot: SOX11 Antibody [NBP1-85823] - Analysis in human cell line SH-SY5Y.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human chronic lymphocytic leukemia shows no nuclear positivity in tumor cells as expected.
Immunohistochemistry-Paraffin: SOX11 Antibody [NBP1-85823] - Staining of human mantle cell lymphoma shows moderate to strong nuclear positivity in tumor cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ChIP, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOX11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: FMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKK
Specificity
Specificity of human SOX11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOX11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Chromatin Immunoprecipitation
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC, ChIP, WB reported in scientific literature (PMID: 24681958). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SOX11 Protein (NBP1-85823PEP)
Publications
Read Publications using
NBP1-85823 in the following applications:

  • 1 publication
  • IHC
    4 publications
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (82%). Human reactivity reported in scientific literature (PMID: 24681958).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOX11 Antibody

  • SOX11
  • SRY (sex determining region Y)-box 11
  • SRY (sex-determining region Y)-box 11
  • SRY-related HMG-box gene 11
  • transcription factor SOX-11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-61420
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB2018
Species: Hu, Mu, Rt
Applications: WB, Simple Western, CyTOF-reported, ICC, ICFlow
AF3075
Species: Hu
Applications: WB, Simple Western, ICC
AF2569
Species: Hu
Applications: WB, ICC
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
AF4070
Species: Hu
Applications: WB, ICC
H00006666-B01P
Species: Hu, Mu
Applications: WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2806
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2864
Species: Hu
Applications: WB, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-36953
Species: Hu
Applications: WB, PEP-ELISA
AF5286
Species: Hu
Applications: WB
NBP1-49872
Species: Mu
Applications: WB, IHC, IHC-Fr, PEP-ELISA
NBP2-59059
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85816
Species: Hu, Mu, Rt, Fe
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KO
NBP2-54978
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF3369
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP1-85823
Species: Hu
Applications: WB, ChIP, IHC, IHC-P

Publications for SOX11 Antibody (NBP1-85823)(20)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ChIP, IHC, WB.


Filter By Application
ChIP
(1)
IHC
(4)
WB
(1)
All Applications
Filter By Species
Human
(3)
All Species
Showing Publications 1 - 10 of 20. Show All 20 Publications.
Publications using NBP1-85823 Applications Species
Righi S, Pileri S, Agostinelli C et al. Reproducibility of SOX-11 detection in decalcified bone marrow tissue in mantle cell lymphoma patients. Hum. Pathol. Oct 5 2016 [PMID: 27720733] (IHC) IHC
Inmaculada Ribera-Cortada, Daniel Martinez, Virginia Amador et al. Plasma cell and terminal B-cell differentiation in mantle cell lymphoma mainly occur in the SOX11-negative subtype. Modern Pathology 2015 Sep 11 [PMID: 26360498] (IHC, Human) IHC Human
Davidson B, Holth A, Hellesylt E et al. The clinical role of epithelial-mesenchymal transition and stem cell markers in advanced-stage ovarian serous carcinoma effusions. Hum Pathol 2015 Jan [PMID: 25455994] (IHC, Human) IHC Human
Kuo PY, Leshchenko VV, Fazzari MJ et al. High resolution Chromatin Immunoprecipitation (Chromatin Immunoprecipitation) sequencing reveals novel bindings targets and prognostic role for SOX11 in Mantle cell lymphoma. Oncogene 2015 Mar 5 [PMID: 24681958] (IHC, ChIP, WB, Human) IHC, ChIP, WB Human
Nygren L, Baumgartner Wennerholm S, Klimkowska M et al. Prognostic role of SOX11 in a population-based cohort of mantle cell lymphoma. Blood 2012 May [PMID: 22431568]
Carvajal-Cuenca A, Sua LF, Silva NM et al. In situ mantle cell lymphoma: clinical implications of an incidental finding with indolent clinical behavior. Haematologica 2012 Feb [PMID: 22058203]
Sernbo S, Gustavsson E, Brennan DJ et al. The tumour suppressor SOX11 is associated with improved survival among high grade epithelial ovarian cancers and is regulated by reversible promoter methylation. BMC Cancer 2011 Sep [PMID: 21943380]
Kimura Y, Sato K, Imamura Y et al. Small cell variant of mantle cell lymphoma is an indolent lymphoma characterized by bone marrow involvement, splenomegaly, and a low Ki-67 index. Cancer Sci 2011 Sep [PMID: 21609366]
Ondrejka SL, Lai R, Smith SD et al. Indolent mantle cell leukemia: a clinicopathological variant characterized by isolated lymphocytosis, interstitial bone marrow involvement, kappa light chain restriction, and good prognosis. Haematologica 2011 Aug [PMID: 21508124]
Cao X, Fan L, Fang C et al. The expression of SOX11, cyclin D1, cyclin D2, and cyclin D3 in B-cell lymphocytic proliferative diseases. Med Oncol 2012 Jun [PMID: 21479697]
Show All 20 Publications.

Reviews for SOX11 Antibody (NBP1-85823) (0)

There are no reviews for SOX11 Antibody (NBP1-85823). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ChIP Video Protocol
ChIP Webinar

FAQs for SOX11 Antibody (NBP1-85823) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SOX11 Products

Bioinformatics Tool for SOX11 Antibody (NBP1-85823)

Discover related pathways, diseases and genes to SOX11 Antibody (NBP1-85823). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOX11 Antibody (NBP1-85823)

Discover more about diseases related to SOX11 Antibody (NBP1-85823).
 

Pathways for SOX11 Antibody (NBP1-85823)

View related products by pathway.

PTMs for SOX11 Antibody (NBP1-85823)

Learn more about PTMs related to SOX11 Antibody (NBP1-85823).

Blogs on SOX11.

SOX-11 seals your fate
The SOX-11 transcription factor is a member of the SOX family known to be involved in embryonic development regulation and cell fate determination. The protein acts as a transcriptional regulator and appears to modulate fundamental aspects of normal e...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOX11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOX11