Sortilin Antibody (CL6528)

Images

 
Western Blot: Sortilin Antibody (CL6528) [NBP2-76501] - Analysis in Rh30 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-SORT1 antibody. Remaining relative intensity is presented. ...read more
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Staining of mouse hippocampus shows strong cytoplasmic positivity in both pyramidal neurons and granular cells.
Western Blot: Sortilin Antibody (CL6528) [NBP2-76501] - Analysis in human cell line SK-MEL-30.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Analysis in human cerebral cortex and tonsil tissues. Corresponding SORT1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Immunohistochemistry-Paraffin: Sortilin Antibody (CL6528) [NBP2-76501] - Staining of mouse cerebral cortex shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P, KD
Clone
CL6528
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Sortilin Antibody (CL6528) Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKD
Epitope
CVEQPELKGH
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
SORT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (89%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Sortilin Antibody (CL6528)

  • 100 kDa NT receptor
  • Glycoprotein 95
  • Gp95
  • Gp95LDLCQ6
  • Neurotensin receptor 3
  • NT3NTR3
  • Ntr3
  • SORT1
  • sortilin 1
  • Sortilin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB367
Species: Hu, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP2-33903
Species: Hu
Applications: IHC, IHC-P
NBP1-47897
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1404
Species: Mu, Rt
Applications: WB, Simple Western, IHC, Block
NLS938
Species: Hu
Applications: IHC, IHC-P
NB110-40561
Species: Hu
Applications: WB, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00003059-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, PLA, RNAi, S-ELISA
MAB224
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr
H00007170-M02
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
AF1138
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-85740
Species: Hu, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-76501
Species: Hu, Mu
Applications: WB, IHC, IHC-P, KD

Publications for Sortilin Antibody (NBP2-76501) (0)

There are no publications for Sortilin Antibody (NBP2-76501).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sortilin Antibody (NBP2-76501) (0)

There are no reviews for Sortilin Antibody (NBP2-76501). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sortilin Antibody (NBP2-76501) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Sortilin Products

Bioinformatics Tool for Sortilin Antibody (NBP2-76501)

Discover related pathways, diseases and genes to Sortilin Antibody (NBP2-76501). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sortilin Antibody (NBP2-76501)

Discover more about diseases related to Sortilin Antibody (NBP2-76501).
 

Pathways for Sortilin Antibody (NBP2-76501)

View related products by pathway.

PTMs for Sortilin Antibody (NBP2-76501)

Learn more about PTMs related to Sortilin Antibody (NBP2-76501).
 

Research Areas for Sortilin Antibody (NBP2-76501)

Find related products by research area.

Blogs on Sortilin

There are no specific blogs for Sortilin, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Sortilin Antibody (CL6528) and receive a gift card or discount.

Bioinformatics

Gene Symbol SORT1