Home » SorCS1 » SorCS1 Antibodies » SorCS1 Antibody

SorCS1 Antibody

 (1 Publication)
 (4 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SorCS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04 - 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 29440124). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SorCS1 Recombinant Protein Antigen (NBP1-86096PEP)
Reviewed Applications
Read 4 Reviews rated 4.3
using
NBP1-86096 in the following applications:
Publications
Read Publication using NBP1-86096.

Reactivity Notes

Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SorCS1 Antibody

  • FLJ41758
  • FLJ43475
  • FLJ44957
  • hSorCS
  • SORCS receptor 1
  • SORCS
  • SorCS1
  • sortilin-related VPS10 domain containing receptor 1
  • VPS10 domain receptor protein SORCS 1
  • VPS10 domain receptor SorCS
  • VPS10 domain-containing receptor SorCS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SorLA Antibody
[Unconjugated]
AF5699
Western blot shows lysates of Neuro‑2A mouse neuroblastoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human SorLA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5699) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SorLA at approximately 330 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SorLA was detected in immersion fixed paraffin-embedded sections of human brain using Sheep Anti-Human/Mouse SorLA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5699) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: WB, IHC
Sortilin Antibody
[Unconjugated]
AF2934
Sortilin was detected in perfusion fixed frozen sections of mouse brain (rostral ventral medulla) using Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse brain (total) tissue, mouse brain (cerebellum) tissue, and mouse brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Sortilin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain (cortex) tissue, loaded at 0.2 mg/mL. A specific band was detected for Sortilin at approximately 122 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(8 Reviews)
(7 Publications)
Species: Mu
Applications: WB, Simple Western, IHC, Block
SorCS3 Antibody
AF3067
SorCS3 was detected in immersion fixed frozen sections of mouse brain (hippocampus) using 10 µg/mL Goat Anti-Mouse SorCS3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3067) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: WB, IHC, Block
SorCS2 Antibody
[Unconjugated]
AF4237
SorCS2 was detected in perfusion fixed frozen sections of mouse brain using Sheep Anti-Mouse SorCS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4237) at 15 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
SorCS2 was detected in perfusion fixed frozen sections of mouse brain using Sheep Anti-Mouse SorCS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4237) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(4 Publications)
Species: Mu
Applications: WB, IHC
beta Amyloid
Antibody (MOAB-2)
NBP2-13075
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - IHC analysis of beta Amyloid on normal mouse brain (left) and 5xFAD mouse brain (right) using DAB with hematoxylin counterstain. The MOAB-2 antibody was used at 1:20 on normal mouse brain and at 1:400 on 5xFAD mouse brain.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Analysis of beta Amyloid (MOAB-2) antibody in (1) 100 pmole beta Amyloid 42, (2) 5xFAD mouse brain homogenate Repetition 1 and (3) 5xFAD mouse brain homogenate Repetition 2.
Western Blot: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Western blot analysis in cell lysates from HEK-APP SWE/BACE1 cells probed with an antibody against the C-terminus of APP (Lanes 1 and 2) and beta Amyloid (MOAB-2, Lanes 3 and 4). Beta Amyloid (MOAB-2) does not detect APP (from PMID: 22423893).
(2 Reviews)
(37 Publications)
Species: Hu, Mu, Rt, Ba, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Apolipoprotein
E/ApoE Antibody (WUE-
NB110-60531
Immunohistochemistry-Paraffin: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE was detected in immersion fixed paraffin-embedded sections of human liver using anti-human mouse monoclonal antibody (Catalog # NB110-60531) at 1:200 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(25 Publications)
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, Flow-IC
BDNF [HRP]
DBD00
(4 Reviews)
(61 Publications)
Species: Hu
Holo-Transferrin
2914-HT
Holo-Transferrin
(2 Reviews)
(24 Publications)
Species: Hu
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(18 Publications)
Species: Hu
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(19 Reviews)
(442 Publications)
Species: Hu
Nicotinic
Acetylcholine Recepto ...
NBP1-28467
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP1-28467] - Analysis of Nicotinic Acetylcholine Receptor beta 2 in Human Cerebellum lysate (35ug protein in RIPA buffer) using NBP1-28467 at 1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP1-28467] - (2.5ug/ml) staining of Human Uterus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Tnk1 Antibody
NBP2-85965
Western Blot: Tnk1 Antibody [NBP2-85965] - Host: Rabbit. Target Name: TNK1. Antibody Dilution: 1.0ug/ml. Sample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226
Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP2-85965] - Rabbit Anti-TNK1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Species: Hu
Applications: WB, IHC, IHC-P
PrPC Antibody
(SC57-05)
NBP2-67569
Western Blot: PrPC Antibody (SC57-05) [NBP2-67569] - Western blot analysis of PrPC protein on rat brain tissue lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1/500) was used in 5% BSA at room temperature for 2 hours
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in N2A cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: PrPC Antibody (SC57-05) [NBP2-67569] - Analysis of paraffin-embedded rat brain tissue using anti-PrPC antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Western Blot: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Probing of Western blots of pancreatic lysates from control and iron overloaded Tg40 PrP and PrP-/- mice with antibodies specific for insulin dimer and pentamer (upper and lower panels) shows decreased expression in Tg40 PrP relative to PrP-/- samples (lanes 1 & 5 vs. 3 & 7). Image collected and cropped by CiteAb from the following publication (nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Immunohistochemistry of pancreas shows relatively higher reactivity for insulin in PrP-/- relative to Tg40 PrP sections (panels 1 & 3). Iron overloading decreases insulin reactivity in Tg40 PrP but not in PrP-/- samples (panels 1 vs. 2 & 3 vs. 4). Reaction for glucagon is higher in iron overloaded Tg40 PrP relative to control samples (panels 5 & 6). The difference is minimal in PrP-/- samples (panels 7 & 8). Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/s41598-018-24786-1), licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
(5 Reviews)
(2 Publications)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Clusterin/APOJ
[HRP]
DCLU00
(2 Reviews)
(11 Publications)
Species: Hu
mtTFA Antibody
(18G102B2E11)
NBP1-71648
Simple Western: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Simple Western lane view shows a specific band for mtTFA in 0.5 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Knockdown Validated: mtTFA Antibody (18G102B2E11) [NBP1-71648] - MtDNA depletion and reversible impaired immune functions in THP-1A cells. A and B, Treatment with 50A ng/mL ethidium bromide (EtBr) for 8A weeks. Transfection with 30A nmol/L negative or TFAM siRNA for 8A days. TFAM protein relative toI2-actin. D, MtDNA levels. E, LPS-induced TNF-I+-and IL-8 release. Image collected and cropped by Citeab from the following publication (Mitochondrial DNA depletion induces innate immune dysfunction rescued by IFN-g. J Allergy Clin Immunol (2017)) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: mtTFA Antibody (18G102B2E11) [NBP1-71648] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-mtTFA Antibody (18G102B2E11) NBP1-71648 at 1 ug/ml overnight at 4C and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(2 Reviews)
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD, KO
Cystatin C [HRP]
MSCTC0
(1 Review)
(24 Publications)
Species: Mu, Rt
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
DAP Kinase 1
Antibody (12B2)
NBP2-76835
Western Blot: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Western blot analysis of DAP Kinase 1 on rat brain tissue lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody was used at a 1:500 dilution in 5% BSA at room temperature for 2 hours. Goat Anti-Mouse IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunohistochemistry: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Immunohistochemical analysis of paraffin-embedded mouse liver tissue using anti-DAP Kinase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/50 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Immunohistochemistry: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Immunohistochemical analysis of paraffin-embedded rat lung tissue using anti-DAP Kinase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/50 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
SorCS1 Antibody
NBP1-86096
SorCS1 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SorCS1 Antibody (NBP1-86096)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SorCS1 Antibody (NBP1-86096) (4) 4.34

Average Rating: 4.3
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-86096:
Filter by Applications
WB
(3)
IP
(1)
All Applications
Filter by Species
Human
(3)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Verified Customer
 WB Mouse 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO cells stable expressing mouse SorCS1
SpeciesMouse

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  4
reviewed by:
Verified Customer
 WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO-cells stable expressing human SorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  4
reviewed by:
Verified Customer
 IP Human 12/17/2014
View

Summary

ApplicationImmunoprecipitation
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  5
reviewed by:
Verified Customer
 WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFive-star review on pAbmAbs http://pabmabs.com/

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SorCS1 Antibody (NBP1-86096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional SorCS1 Products

Bioinformatics Tool for SorCS1 Antibody (NBP1-86096)

Discover related pathways, diseases and genes to SorCS1 Antibody (NBP1-86096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SorCS1 Antibody (NBP1-86096)

Discover more about diseases related to SorCS1 Antibody (NBP1-86096).
 

Pathways for SorCS1 Antibody (NBP1-86096)

View related products by pathway.

PTMs for SorCS1 Antibody (NBP1-86096)

Learn more about PTMs related to SorCS1 Antibody (NBP1-86096).

Blogs on SorCS1

There are no specific blogs for SorCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
3
3
0
2
0
1
0
 
 Verified Customer
12/17/2014
Application: WB
Species: Mouse
read this review
 
 Verified Customer
12/17/2014
Application: WB
Species: Human
read this review
 
 Verified Customer
12/17/2014
Application: IP
Species: Human
read this review

Bioinformatics

Gene Symbol SORCS1