Home » SorCS1 » SorCS1 Antibodies » SorCS1 Antibody

SorCS1 Antibody

 (1 Publication)
 (4 Reviews)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunocytochemistry/ Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.
Genetic Strategies: Knockout Validated: SorCS1 Antibody [NBP1-86096] - Altered subcellular localization of TrkB in primary neurons and brains from S1/3 KO mice. Co-immunoprecipitation of SorCS1 with TrkB. TrkB ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

SorCS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot 0.04 - 0.4 ug/ml
Application Notes
WB reported in scientific literature (PMID: 29440124). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SorCS1 Recombinant Protein Antigen (NBP1-86096PEP)
Reviewed Applications
Read 4 Reviews rated 4.3
using
NBP1-86096 in the following applications:
Publications
Read Publication using NBP1-86096.

Reactivity Notes

Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SorCS1 Antibody

  • FLJ41758
  • FLJ43475
  • FLJ44957
  • hSorCS
  • SORCS receptor 1
  • SORCS
  • SorCS1
  • sortilin-related VPS10 domain containing receptor 1
  • VPS10 domain receptor protein SORCS 1
  • VPS10 domain receptor SorCS
  • VPS10 domain-containing receptor SorCS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SorLA Antibody
[Unconjugated]
AF5699
SorLA was detected in immersion fixed paraffin-embedded sections of human brain using Sheep Anti-Human/Mouse SorLA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5699) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neurons. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of Neuro‑2A mouse neuroblastoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human SorLA Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5699) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for SorLA at approximately 330 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: IHC, WB
Sortilin Antibody
[Unconjugated]
AF2934
Sortilin was detected in perfusion fixed frozen sections of mouse brain (rostral ventral medulla) using Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) at 1.7 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse brain (total) tissue, mouse brain (cerebellum) tissue, and mouse brain (cortex) tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Sortilin at approximately 110 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse brain (cortex) tissue , loaded at 0.2 mg/mL. A specific band was detected for Sortilin at approximately 122 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse Sortilin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2934) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(8 Reviews)
(7 Publications)
Species: Mu
Applications: Block, IHC, Simple Western, WB
SorCS3 Antibody
AF3067
SorCS3 was detected in immersion fixed frozen sections of mouse brain (hippocampus) using 10 µg/mL Goat Anti-Mouse SorCS3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3067) overnight at 4 °C. Tissue was stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red, upper panel; Catalog # NL001) and counterstained with DAPI (blue, lower panel). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
(1 Publication)
Species: Mu
Applications: Block, IHC, WB
SorCS2 Antibody
[Unconjugated]
AF4237
SorCS2 was detected in perfusion fixed frozen sections of mouse brain using Sheep Anti-Mouse SorCS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4237) at 15 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
SorCS2 was detected in perfusion fixed frozen sections of mouse brain using Sheep Anti-Mouse SorCS2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4237) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
(5 Reviews)
(4 Publications)
Species: Mu
Applications: IHC, WB
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Mouse brain (cerebral cortex). Red: MOAB-2 antibody staining, Blue: DAPI. Zeiss LSM800, 40x. Image from verified customer review.
Immunohistochemistry: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - A plaque load in neocortex and hippocampus in APP/PS1 mice exposed to differential housing. Representative 10x MOAB-2 staining in hippocampus of APP/PS1 mice for each housing group. Environmental novelty exacerbates stress hormones and Aβ pathology in an Alzheimer's model. Sci Rep (2017)
Immunocytochemistry/Immunofluorescence: beta Amyloid Antibody (MOAB-2) [NBP2-13075] - Immunofluorescent detection of beta Amyloid with MOAB-2 in the subiculim of 1-, 2- and 4- month old 5xFAD mice. Scale bar 20 um (from PMID: 22423893).
(2 Reviews)
(43 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Apolipoprotein
E/ApoE Antibody (WUE- ...
NB110-60531
Flow (Intracellular): Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - An intracellular stain was performed on HepG2 cells with NB110-60531AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Detection of ApoE in human tissue lysate using NB110-60531. Lane 1: liver Lane 2: brain
Flow Cytometry: Apolipoprotein E/ApoE Antibody (WUE-4) [NB110-60531] - ApoE Antibody (WUE-4) [NB110-60531] - Intracellular flow cytometric staining of 1 x 10^6 CHO (A) and HEK-293 (B) cells using ApoE antibody (dark blue). Isotype control shown in orange. An antibody concentration of 1 ug/1x10^6 cells was used.
(2 Reviews)
(28 Publications)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
BDNF [HRP]
DBD00
(4 Reviews)
(68 Publications)
Species: Hu
Applications: ELISA
Holo-Transferrin
2914-HT
Holo-Transferrin
(3 Reviews)
(33 Publications)
Species: Hu
Applications: BA
Coagulation Factor
III/Tissue Factor [HR ...
DCF300
(1 Review)
(22 Publications)
Species: Hu
Applications: ELISA
IL-1 beta/IL-1F2
[Unconjugated]
201-LB/CF
1 μg/lane of Recombinant Human IL-1 beta /IL-1F2 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 17 kDa.
Recombinant Human IL-1 beta /IL-1F2 (Catalog # 201-LB/CF) stimulates cell proliferation of the D10.G4.1 mouse helper T cell line. The ED50 for this effect is <12 pg/mL.
(475 Publications)
Species: Hu
Applications: BA
Nicotinic
Acetylcholine Recepto ...
NBP1-28467
Western Blot: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP1-28467] - Analysis of Nicotinic Acetylcholine Receptor beta 2 in Human Cerebellum lysate (35ug protein in RIPA buffer) using NBP1-28467 at 1ug/ml. Primary incubation was 1 hour. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: Nicotinic Acetylcholine Receptor beta 2 Antibody [NBP1-28467] - (2.5ug/ml) staining of Human Uterus. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Tnk1 Antibody
NBP2-85965
Western Blot: Tnk1 Antibody [NBP2-85965] - Host: Rabbit. Target Name: TNK1. Antibody Dilution: 1.0ug/ml. Sample Type: RPMI-8226 cell lysateTNK1 is supported by BioGPS gene expression data to be expressed in RPMI 8226
Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP2-85965] - Rabbit Anti-TNK1 antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult Skeletal muscle. Observed Staining: Cytoplasm in hepatocytes. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy3. Secondary Antibody Concentration: 1:200. Magnification: 20X.
Species: Hu
Applications: IHC, IHC-P, WB
PrPC Antibody
(SC57-05)
NBP2-67569
Flow Cytometry: PrPC Antibody (SC57-05) [NBP2-67569] - Analysis of SH-SY-5Y cells with PrPC antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SHG-44 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: PrPC Antibody (SC57-05) [NBP2-67569] - Staining PrPC in SH-SY-5Y cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Clusterin/APOJ
[HRP]
DCLU00
(3 Reviews)
(11 Publications)
Species: Hu
Applications: ELISA
mtTFA Antibody
(18G102B2E11)
NBP1-71648
Western Blot: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Alcohol feeding significantly decreased TFAM expression in rat liver. This image was submitted by a customer review.
Knockdown Validated: mtTFA Antibody (18G102B2E11) [NBP1-71648] - MtDNA depletion and reversible impaired immune functions in THP-1A cells. A and B, Treatment with 50A ng/mL ethidium bromide (EtBr) for 8A weeks. Transfection with 30A nmol/L negative or TFAM siRNA for 8A days. TFAM protein relative toI2-actin. D, MtDNA levels. E, LPS-induced TNF-I+-and IL-8 release. Image collected and cropped by Citeab from the following publication (Mitochondrial DNA depletion induces innate immune dysfunction rescued by IFN-g. J Allergy Clin Immunol (2017)) licensed under a CC-BY licence.
Western Blot: mtTFA Antibody (18G102B2E11) [NBP1-71648] - Induction of mitochondrial biogenesis following exposure of THP-1 cells to LPS. THP-1 cells were incubated with LPS (100 ng/ml) for 0AE
(2 Reviews)
(12 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
Cystatin C [HRP]
MSCTC0
(1 Review)
(25 Publications)
Species: Mu, Rt
Applications: ELISA
ACE/CD143 Antibody
[Unconjugated]
AF1513
ACE/CD143 was detected in perfusion fixed frozen sections of mouse kidney using 15 µg/mL Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) overnight at 4 °C. Tissue was stained (red). View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Western blot shows lysates of mouse lung tissue. PVDF membrane was probed with 0.05 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for ACE/CD143 at approximately 180 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of mouse lung tissue, loaded at 0.2 mg/mL. A specific band was detected for ACE/CD143 at approximately 218 kDa (as indicated) using 10 µg/mL of Goat Anti-Mouse ACE/CD143 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1513) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 66-440 kDa separation system.
(1 Review)
(4 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
DAP Kinase 1
Antibody (12B2)
NBP2-76835
Western Blot: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Western blot analysis of DAP Kinase 1 on rat brain tissue lysate. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody was used at a 1:500 dilution in 5% BSA at room temperature for 2 hours. Goat Anti-Mouse IgG - HRP Secondary Antibody at 1:5,000 dilution was used for 1 hour at room temperature.
Immunohistochemistry: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Immunohistochemical analysis of paraffin-embedded rat lung tissue using anti-DAP Kinase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/50 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Immunohistochemistry: DAP Kinase 1 Antibody (12B2) [NBP2-76835] - Immunohistochemical analysis of paraffin-embedded human lung cancer tissue using anti-DAP Kinase 1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the antibody at 1/200 dilution, for 30 minutes at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chrogen. Counter stained with hematoxylin and mounted with DPX.
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SorCS1 Antibody
NBP1-86096
SorCS1 Antibody
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KO

Publications for SorCS1 Antibody (NBP1-86096)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SorCS1 Antibody (NBP1-86096) (4) 4.34

Average Rating: 4.3
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-86096:
Filter by Applications
WB
(3)
IP
(1)
All Applications
Filter by Species
Human
(3)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Verified Customer
 WB Mouse 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO cells stable expressing mouse SorCS1
SpeciesMouse

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  4
reviewed by:
Verified Customer
 WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO-cells stable expressing human SorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  4
reviewed by:
Verified Customer
 IP Human 12/17/2014
View

Summary

ApplicationImmunoprecipitation
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
  5
reviewed by:
Verified Customer
 WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFive-star review on pAbmAbs http://pabmabs.com/

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SorCS1 Antibody (NBP1-86096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SorCS1 Products

Bioinformatics Tool for SorCS1 Antibody (NBP1-86096)

Discover related pathways, diseases and genes to SorCS1 Antibody (NBP1-86096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SorCS1 Antibody (NBP1-86096)

Discover more about diseases related to SorCS1 Antibody (NBP1-86096).
 

Pathways for SorCS1 Antibody (NBP1-86096)

View related products by pathway.

PTMs for SorCS1 Antibody (NBP1-86096)

Learn more about PTMs related to SorCS1 Antibody (NBP1-86096).

Blogs on SorCS1

There are no specific blogs for SorCS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
3
3
0
2
0
1
0
 
 Verified Customer
12/17/2014
Application: WB
Species: Mouse
read this review
 
 Verified Customer
12/17/2014
Application: WB
Species: Human
read this review
 
 Verified Customer
12/17/2014
Application: IP
Species: Human
read this review

Bioinformatics

Gene Symbol SORCS1