SorCS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human colon shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SorCS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SorCS1 Recombinant Protein Antigen (NBP1-86096PEP)
Reviewed Applications
Read 4 Reviews rated 4.3
using
NBP1-86096 in the following applications:

Reactivity Notes

Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SorCS1 Antibody

  • FLJ41758
  • FLJ43475
  • FLJ44957
  • hSorCS
  • SORCS receptor 1
  • SORCS
  • SorCS1
  • sortilin-related VPS10 domain containing receptor 1
  • VPS10 domain receptor protein SORCS 1
  • VPS10 domain receptor SorCS
  • VPS10 domain-containing receptor SorCS1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5699
Species: Hu, Mu
Applications: WB, IHC
AF2934
Species: Mu
Applications: WB, Simple Western, IHC, Block
AF3067
Species: Mu
Applications: WB, IHC, Block
AF4237
Species: Mu
Applications: WB, IHC
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-44235
Species: Ce, Pl
Applications: WB, ELISA, IHC
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
NBP1-86477
Species: Hu
Applications: IHC, IHC-P
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-71648
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-86096
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SorCS1 Antibody (NBP1-86096) (0)

There are no publications for SorCS1 Antibody (NBP1-86096).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SorCS1 Antibody (NBP1-86096) (4) 4.34

Average Rating: 4.3
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.
We have 4 reviews tested in 2 application: WB, IP.

Reviews using NBP1-86096:
Filter by Applications
WB
(3)
IP
(1)
All Applications
Filter by Species
Human
(3)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
 
reviewed by:
Anonymous
WB Mouse 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO cells stable expressing mouse SorCS1
SpeciesMouse

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
 
reviewed by:
Anonymous
WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO-cells stable expressing human SorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
 
reviewed by:
Anonymous
IP Human 12/17/2014
View

Summary

ApplicationImmunoprecipitation
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFour-star review on pAbmAbs http://pabmabs.com/
 
reviewed by:
Anonymous
WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman sorCS1
SpeciesHuman

Blocking

Blocking Detailsn/a

Details

Detection Notesn/a

Comments

CommentsFive-star review on pAbmAbs http://pabmabs.com/

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SorCS1 Antibody (NBP1-86096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SorCS1 Products

Bioinformatics Tool for SorCS1 Antibody (NBP1-86096)

Discover related pathways, diseases and genes to SorCS1 Antibody (NBP1-86096). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SorCS1 Antibody (NBP1-86096)

Discover more about diseases related to SorCS1 Antibody (NBP1-86096).
 

Pathways for SorCS1 Antibody (NBP1-86096)

View related products by pathway.

PTMs for SorCS1 Antibody (NBP1-86096)

Learn more about PTMs related to SorCS1 Antibody (NBP1-86096).

Blogs on SorCS1

There are no specific blogs for SorCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
3
3
0
2
0
1
0

 
Anonymous
12/17/2014
Application: WB
Species: Mouse

 
Anonymous
12/17/2014
Application: WB
Species: Human

 
Anonymous
12/17/2014
Application: IP
Species: Human

Bioinformatics

Gene Symbol SORCS1
Entrez