SorCS1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SorCS1 Antibody [NBP1-86096] - Staining of human cell line U-251 MG shows localization to plasma membrane & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human cerebral cortex shows moderate positivity in neuronal processes.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human small intestine shows strong positivity in apical membrane in glandular cells.
Immunohistochemistry-Paraffin: SorCS1 Antibody [NBP1-86096] - Staining of human lymph node shows moderate membranous positivity in germinal center cells.
Genetic Strategies: Knockout Validated: SorCS1 Antibody [NBP1-86096] - Altered subcellular localization of TrkB in primary neurons and brains from S1/3 KO mice. Co-immunoprecipitation of SorCS1 with TrkB. TrkB ...read more
Altered subcellular localization of TrkB in primary neurons and brains from S1/3 KO mice. F, G) Co-immunoprecipitation of SORCS1 and SORCS3 with TrkB. TrkB was immunoprecipitated from transiently transfected Chinese ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, KO
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

SorCS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPTTAELFVLPYQDPAGENKRSTDDLEQISELLIHTLNQNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SORCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Knockout Validated
  • Western Blot -Reported in scientific literature (PMID: 29440124)
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SorCS1 Recombinant Protein Antigen (NBP1-86096PEP)
Reviewed Applications
Read 4 Reviews rated 4.3
using
NBP1-86096 in the following applications:

Publications
Read Publication using NBP1-86096.

Reactivity Notes

Mouse (87%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SorCS1 Antibody

  • FLJ41758
  • FLJ43475
  • FLJ44957
  • hSorCS
  • SORCS receptor 1
  • SORCS
  • SorCS1
  • sortilin-related VPS10 domain containing receptor 1
  • VPS10 domain receptor protein SORCS 1
  • VPS10 domain receptor SorCS
  • VPS10 domain-containing receptor SorCS1

Background

The SorCS1 gene encodes one family member of vacuolar protein sorting 10 (VPS10) domain-containing receptor proteins. TheVPS10 domain name comes from the yeast carboxypeptidase Y sorting receptor Vps10 protein. Members of this gene familyare large with many exo

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5699
Species: Hu
Applications: IHC
AF2934
Species: Mu
Applications: Block, IHC, Simple Western, WB
MAB3067
Species: Hu, Mu
Applications: WB
AF4237
Species: Mu
Applications: IHC, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, WB
DBD00
Species: Hu
Applications: ELISA
2914-HT
Species: Hu
Applications: BA
NBP1-28467
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-85965
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56605
Species: Av, Bv, Sh
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
AF2747
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
NBP1-71648
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, KO, Simple Western, WB
MSCTC0
Species: Mu, Rt
Applications: ELISA
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP3-21649
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-86096
Species: Hu
Applications: WB, ICC/IF, IHC, KO

Publications for SorCS1 Antibody (NBP1-86096)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for SorCS1 Antibody (NBP1-86096) (4) 4.34

Average Rating: 4.3
(Based on 4 reviews)
We have 4 reviews tested in 2 species: Human, Mouse.

Reviews using NBP1-86096:
Filter by Applications
WB
(3)
IP
(1)
All Applications
Filter by Species
Human
(3)
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
  4
reviewed by:
Verified Customer
WB Mouse 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO cells stable expressing mouse SorCS1
SpeciesMouse
  4
reviewed by:
Verified Customer
WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample TestedCHO-cells stable expressing human SorCS1
SpeciesHuman
  4
reviewed by:
Verified Customer
IP Human 12/17/2014
View

Summary

ApplicationImmunoprecipitation
Sample Testedhuman sorCS1
SpeciesHuman
  5
reviewed by:
Verified Customer
WB Human 12/17/2014
View

Summary

ApplicationWestern Blot
Sample Testedhuman sorCS1
SpeciesHuman

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SorCS1 Antibody (NBP1-86096) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SorCS1 Products

Diseases for SorCS1 Antibody (NBP1-86096)

Discover more about diseases related to SorCS1 Antibody (NBP1-86096).
 

Pathways for SorCS1 Antibody (NBP1-86096)

View related products by pathway.

PTMs for SorCS1 Antibody (NBP1-86096)

Learn more about PTMs related to SorCS1 Antibody (NBP1-86096).

Blogs on SorCS1

There are no specific blogs for SorCS1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4.3
5
1
4
3
3
0
2
0
1
0

 
Verified Customer
12/17/2014
Application: WB
Species: Mouse

 
Verified Customer
12/17/2014
Application: WB
Species: Human

 
Verified Customer
12/17/2014
Application: IP
Species: Human

Bioinformatics

Gene Symbol SORCS1