Tnk1 Antibody

Images

 
Immunohistochemistry-Paraffin: Tnk1 Antibody [NBP1-86477] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells and cells in molecular layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Tnk1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PSEACCVRDVTEPGALRMETGDPITVIEGSPDSTIWKGQNGRTFKVGSFPASAVTLADAGGLPATRPVHRGTPARGDQHPGSIDGDRKKANLWDAPPARGQRRNMPLERMKGISRSLESVLSLG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tnk1 Protein (NBP1-86477PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tnk1 Antibody

  • CD38 negative kinase 1
  • EC 2.7.10
  • EC 2.7.10.2
  • MGC46193
  • non-receptor tyrosine-protein kinase TNK1
  • tyrosine kinase, non-receptor, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-86658
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-30821
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF4877
Species: Hu
Applications: WB
NBP2-19782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-56690
Species: Hu
Applications: ICC/IF
NBP1-28467
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
AF5699
Species: Hu, Mu
Applications: WB, IHC
AF3457
Species: Hu
Applications: WB, ICC
MAB38461
Species: Hu
Applications: WB, IHC
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-32311
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15139
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86477
Species: Hu
Applications: IHC, IHC-P

Publications for Tnk1 Antibody (NBP1-86477) (0)

There are no publications for Tnk1 Antibody (NBP1-86477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tnk1 Antibody (NBP1-86477) (0)

There are no reviews for Tnk1 Antibody (NBP1-86477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tnk1 Antibody (NBP1-86477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tnk1 Products

Bioinformatics Tool for Tnk1 Antibody (NBP1-86477)

Discover related pathways, diseases and genes to Tnk1 Antibody (NBP1-86477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tnk1 Antibody (NBP1-86477)

Discover more about diseases related to Tnk1 Antibody (NBP1-86477).
 

Pathways for Tnk1 Antibody (NBP1-86477)

View related products by pathway.

PTMs for Tnk1 Antibody (NBP1-86477)

Learn more about PTMs related to Tnk1 Antibody (NBP1-86477).
 

Research Areas for Tnk1 Antibody (NBP1-86477)

Find related products by research area.

Blogs on Tnk1

There are no specific blogs for Tnk1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Tnk1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNK1