SOD2/Mn-SOD Antibody - BSA Free

Immunohistochemistry-Paraffin: SOD2/Mn-SOD Antibody [NBP1-86169] - Staining of human skeletal muscle shows moderate granular cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: SOD2/Mn-SOD Antibody [NBP1-86169] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: SOD2/Mn-SOD Antibody [NBP1-86169] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line U-87 MG.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SOD2/Mn-SOD Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SOD2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 23646114). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SOD2/Mn-SOD Protein (NBP1-86169PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID:19351664)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SOD2/Mn-SOD Antibody - BSA Free

• EC 1.15.1.1
• indophenoloxidase B
• IPOB
• IPO-B
• manganese-containing superoxide dismutase
• mangano-superoxide dismutase
• Mn SOD
• Mn superoxide dismutase
• MnSOD
• MVCD6
• SOD, Mitochodrial
• SOD2
• superoxide dismutase [Mn], mitochondrial
• superoxide dismutase 2, mitochondrial

Background

Superoxide dismutase (SOD) is responsible for the elimination of cytotoxic active oxygen by catalyzing the dismutation of the superoxide radical to oxygen and hydrogen peroxide (1, 2, 3). There are three SOD isoenzymes in mammalian cells. They are: extracellular SOD (EC SOD), copper and zinc-containing SOD (CuZn SOD) and manganese-containing SOD (Mn SOD, SOD-2). The CuZn form contains Cu and Zn ions and exists as a 32 kDa dimer in the cytosol. Mn SOD is an 80 kDa tetramer that contains Mn ion and resides in the mitochondrial matrix. Mn SOD is a tumor necrosis factor (TNF)-inducible enzyme that protects cells from NFmediated apoptosis (4) via superoxide anion detoxification and the subsequent regulation of apoptosis through cytochrome c release and the modulation of the redox state of the mitochondria (6). Mn SOD has also been shown to be a tumor suppressor in human breast cancer (7). Overexpression of this enzyme protects neurons from NMDAand nitric oxide-induced neurotoxicity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SOD2/Mn-SOD Antibody (NBP1-86169)(3)

Publications using NBP1-86169

• Arimappamagan A, Somasundaram K, Thennarasu K et al. A Fourteen Gene GBM Prognostic Signature Identifies Association of Immune Response Pathway and Mesenchymal Subtype with High Risk Group. PLoS One 2013-01-01 [PMID: 23646114] (IF/IHC)
• Lindfors C, Nilsson IA, Garcia-Roves PM et al. Hypothalamic mitochondrial dysfunction associated with anorexia in the anx/anx mouse. Proc Natl Acad Sci U S A 2011-11-01 [PMID: 22025706]
• Mulder J, Bjorling E, Jonasson K et al. Tissue Profiling of the Mammalian Central Nervous System Using Human Antibody-based Proteomics. Mol Cell Proteomics 2009-07-01 [PMID: 19351664]

Bioinformatics

• Gene Symbol: SOD2