SOD2/Mn-SOD Antibody

Images

 
Western Blot: SOD2/Mn-SOD Antibody [NBP1-86169] - Analysis in human cell line U-87 MG.
Immunohistochemistry-Paraffin: SOD2/Mn-SOD Antibody [NBP1-86169] - Staining of human colon shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: SOD2/Mn-SOD Antibody [NBP1-86169] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SOD2/Mn-SOD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SOD2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SOD2/Mn-SOD Protein (NBP1-86169PEP)
Publications
Read Publications using NBP1-86169.

Reactivity Notes

Reactivity reported in scientific literature (PMID:19351664)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SOD2/Mn-SOD Antibody

  • EC 1.15.1.1
  • indophenoloxidase B
  • IPOB
  • IPO-B
  • manganese-containing superoxide dismutase
  • mangano-superoxide dismutase
  • Mn SOD
  • Mn superoxide dismutase
  • MnSOD
  • MVCD6
  • SOD, Mitochodrial
  • SOD2
  • superoxide dismutase [Mn], mitochondrial
  • superoxide dismutase 2, mitochondrial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3798
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-50179
Species: Hu
Applications: WB, Flow, Func, ICC/IF, IP, CyTOF-ready
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P

Publications for SOD2/Mn-SOD Antibody (NBP1-86169)(3)

Reviews for SOD2/Mn-SOD Antibody (NBP1-86169) (0)

There are no reviews for SOD2/Mn-SOD Antibody (NBP1-86169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SOD2/Mn-SOD Antibody (NBP1-86169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SOD2/Mn-SOD Products

Bioinformatics Tool for SOD2/Mn-SOD Antibody (NBP1-86169)

Discover related pathways, diseases and genes to SOD2/Mn-SOD Antibody (NBP1-86169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SOD2/Mn-SOD Antibody (NBP1-86169)

Discover more about diseases related to SOD2/Mn-SOD Antibody (NBP1-86169).
 

Pathways for SOD2/Mn-SOD Antibody (NBP1-86169)

View related products by pathway.

PTMs for SOD2/Mn-SOD Antibody (NBP1-86169)

Learn more about PTMs related to SOD2/Mn-SOD Antibody (NBP1-86169).
 

Research Areas for SOD2/Mn-SOD Antibody (NBP1-86169)

Find related products by research area.

Blogs on SOD2/Mn-SOD

There are no specific blogs for SOD2/Mn-SOD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SOD2/Mn-SOD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SOD2
Entrez