Snx6 Antibody

Images

 
Western Blot: Snx6 Antibody [NBP2-13361] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more
Immunocytochemistry/ Immunofluorescence: Snx6 Antibody [NBP2-13361] - Staining of human cell line U-2 OS shows localization to endosomes & lysosomes.
Immunohistochemistry-Paraffin: Snx6 Antibody [NBP2-13361] - Staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Snx6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLGAAMMEGLDDGPDFLSEEDRGLKAINVDLQSDAALQVDISDALSE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Snx6 Protein (NBP2-13361PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (87%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Snx6 Antibody

  • MGC3157
  • MSTP010
  • sorting nexin 6
  • sorting nexin-6
  • TFAF2
  • TRAF4-associated factor 2
  • tumor necrosis factor receptor-associated factor 4(TRAF4)-associated factor 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-282
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-1362
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00025855-M01
Species: Hu
Applications: WB, ELISA, IP
NBP2-36754
Species: Hu
Applications: WB, IB, ICC/IF, IHC
NB100-1397
Species: Hu, Mu, Rt, ChHa
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13361
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Snx6 Antibody (NBP2-13361) (0)

There are no publications for Snx6 Antibody (NBP2-13361).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Snx6 Antibody (NBP2-13361) (0)

There are no reviews for Snx6 Antibody (NBP2-13361). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Snx6 Antibody (NBP2-13361) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Snx6 Products

Bioinformatics Tool for Snx6 Antibody (NBP2-13361)

Discover related pathways, diseases and genes to Snx6 Antibody (NBP2-13361). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Snx6 Antibody (NBP2-13361)

Discover more about diseases related to Snx6 Antibody (NBP2-13361).
 

Pathways for Snx6 Antibody (NBP2-13361)

View related products by pathway.

PTMs for Snx6 Antibody (NBP2-13361)

Learn more about PTMs related to Snx6 Antibody (NBP2-13361).
 

Research Areas for Snx6 Antibody (NBP2-13361)

Find related products by research area.

Blogs on Snx6

There are no specific blogs for Snx6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Snx6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNX6