LONP1 Antibody

Images

 
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

LONP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Specificity
Specificity of human, mouse, rat LONP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LONP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
LONP1 Recombinant Protein Antigen (NBP1-81734PEP)
Publications
Read Publications using
NBP1-81734 in the following applications:

  • WB
    5 publications

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LONP1 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.53
  • hLON ATP-dependent protease
  • hLON
  • lon peptidase 1, mitochondrial
  • lon protease homolog, mitochondrial
  • Lon protease-like protein
  • LON
  • LonHS
  • LONP
  • Mitochondrial ATP-dependent protease Lon
  • mitochondrial lon peptidase 1
  • mitochondrial lon protease-like protein
  • PIM1
  • protease, serine, 15
  • PRSS15MGC1498
  • Serine protease 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP1-33549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02441
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-15667
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48515
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
MAB1799
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-27163
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
NBP1-81734
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for LONP1 Antibody (NBP1-81734)(6)

We have publications tested in 2 confirmed species: Human, Drosophila.

We have publications tested in 1 application: WB.


Filter By Application
WB
(5)
All Applications
Filter By Species
Human
(3)
Drosophila
(2)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-81734 Applications Species
Pareek G, Thomas RE, Pallanck LJ. Loss of the Drosophila m-AAA mitochondrial protease paraplegin results in mitochondrial dysfunction, shortened lifespan, and neuronal and muscular degeneration. Cell Death Dis. 2018 Feb 21 [PMID: 29467464] (WB, Drosophila) WB Drosophila
Boutoual R, Meseguer S, Villarroya M et al. Defects in the mitochondrial-tRNA modification enzymes MTO1 and GTPBP3 promote different metabolic reprogramming through a HIF-PPARgamma-UCP2-AMPK axis Sci Rep 2018 Jan 18 [PMID: 29348686] (WB, Human) WB Human
Meseguer S, Boix O, Navarro-Gonzalez C et al. microRNA-mediated differential expression of TRMU, GTPBP3 and MTO1 in cell models of mitochondrial-DNA diseases Sci Rep 2017 Jul 24 [PMID: 28740091] (WB, Human) WB Human
Thomas RE, Andrews LA, Burman JL et al. PINK1-Parkin Pathway Activity Is Regulated by Degradation of PINK1 in the Mitochondrial Matrix. PLoS Genet. 2014 May 01 [PMID: 24874806] (WB, Drosophila)

Details:
Western blot analysis of Lon protease (Lon/LONP1 ) in whole head homogenate from control and Lon deficient Drosophila flies (Figure 1C)
WB Drosophila
Jin SM, Youle RJ. The accumulation of misfolded proteins in the mitochondrial matrix is sensed by PINK1 to induce PARK2/Parkin-mediated mitophagy of polarized mitochondria. Autophagy 2013 Nov 1 [PMID: 24149988] (WB, Human) WB Human
Gozal YM, Duong DM, Gearing M et al. Proteomics analysis reveals novel components in the detergent-insoluble subproteome in Alzheimer's disease. J Proteome Res 2009 Nov [PMID: 19746990]

Reviews for LONP1 Antibody (NBP1-81734) (0)

There are no reviews for LONP1 Antibody (NBP1-81734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LONP1 Antibody (NBP1-81734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LONP1 Antibody (NBP1-81734)

Discover related pathways, diseases and genes to LONP1 Antibody (NBP1-81734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LONP1 Antibody (NBP1-81734)

Discover more about diseases related to LONP1 Antibody (NBP1-81734).
 

Pathways for LONP1 Antibody (NBP1-81734)

View related products by pathway.

Blogs on LONP1

There are no specific blogs for LONP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LONP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LONP1