Home » LONP1 » LONP1 Antibodies » LONP1 Antibody

LONP1 Antibody

 (6 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative ...read more
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734] - Western blot analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left), NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

LONP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Specificity
Specificity of human, mouse, rat LONP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LONP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Simple Western 1:20
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
  • Knockdown Validated
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
LONP1 Recombinant Protein Antigen (NBP1-81734PEP)
Publications
Read Publications using
NBP1-81734 in the following applications:

  • WB
    5 publications

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LONP1 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.53
  • hLON ATP-dependent protease
  • hLON
  • lon peptidase 1, mitochondrial
  • lon protease homolog, mitochondrial
  • Lon protease-like protein
  • LON
  • LonHS
  • LONP
  • Mitochondrial ATP-dependent protease Lon
  • mitochondrial lon peptidase 1
  • mitochondrial lon protease-like protein
  • PIM1
  • protease, serine, 15
  • PRSS15MGC1498
  • Serine protease 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLPP Antibody
NBP1-89557
Western Blot: CLPP Antibody [NBP1-89557] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-CLPP antibody. Remaining relative intensity is presented. Loading control: Anti-PPIB.
Immunocytochemistry/Immunofluorescence: CLPP Antibody [NBP1-89557] - Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
c-Myc Antibody
NB600-335
Western Blot: c-Myc Antibody [NB600-335] - Detection of c-myc-tagged Protein by Western Blot. Samples: 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibodies: Affinity purified, goat anti-c-myc antibody NB600-335 used for WB at 0.04 ug/ml (1:25,000). Detection: Chemiluminescence with an exposure time of 30 seconds.
Immunocytochemistry/Immunofluorescence: c-Myc Antibody [NB600-335] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.5% Triton-X100. The cells were incubated with anti-c-Myc conjugated to Alexa Fluor 488 [NB600-335AF488] at 10ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective. Image from the Alexa Fluor 488 version of this antibody.
Western Blot: c-Myc Antibody [NB600-335] - Analysis using the HRP conjugate of NB600-335. Detection of 200, 100, or 50 ng of E. coli whole cell lysate expressing a multi-tag fusion protein. Antibody used for WB at 0.4 ug/ml (1:25,000).
(1 Review)
(38 Publications)
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
SSB Antibody
NBP1-33549
Western Blot: SSB Antibody [NBP1-33549] - Sample (30 ug of whole cell lysate) A: 293T 10% SDS PAGE; antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: SSB Antibody [NBP1-33549] - Analysis of paraformaldehyde-fixed A431, using SSB (NBP1-33549) antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: SSB Antibody [NBP1-33549] - Paraffin-embedded mouse fore brain. SSB antibody dilution: 1:1000.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
PIM2 Antibody
(OTI5D5)
NBP2-02441
Western Blot: PIM2 Antibody (5D5) [NBP2-02441] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PIM2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PIM2.
Immunocytochemistry/Immunofluorescence: PIM2 Antibody (5D5) [NBP2-02441] Staining of COS7 cells transiently transfected by pCMV6-ENTRY PIM2.
Immunohistochemistry-Paraffin: PIM2 Antibody (5D5) [NBP2-02441] - Staining of paraffin-embedded Human prostate tissue using anti-PIM2 mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
HSP60 Antibody
NBP1-77397
Western Blot: HSP60 Antibody [NBP1-77397] - Western blot analysis of extracts from HeLa and COS cells using NBP1-77397 Hsp60 antibody at 1:1000
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - Confocal immunofluorescent analysis of HeLa cells using Hsp60 antibody (NBP1-77397, 1:100). An Alexa Fluor 488-conjugated Goat to rabbit IgG was used as secondary antibody (green, A). Actin filaments were labeled with Alexa Fluor 568 phalloidin (red, B). DAPI was used to stain the cell nuclei (blue, C).
Immunohistochemistry: HSP60 Antibody [NBP1-77397] - IHC staining of HSP60 in human kidney carcinoma using DAB with hematoxylin counterstain.
(4 Reviews)
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
CALML3 Antibody
NBP2-15667
Western Blot: CALML3 Antibody [NBP2-15667] - Sample (30 ug of whole cell lysate) A: A431 15% SDS PAGE gel, diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: CALML3 Antibody [NBP2-15667] - Analysis of methanol-fixed A431, using antibody at 1:200 dilution.
Immunohistochemistry-Paraffin: CALML3 Antibody [NBP2-15667] - Immunohistochemical analysis of paraffin-embedded breast ca, using antibody at 1:500 dilution.
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Coactosin-like
Protein 1/CotL1 Antib
NBP2-48515
Western Blot: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human liver tissueLane 6: Human tonsil tissue
Immunohistochemistry-Paraffin: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Staining in human lymph node and skeletal muscle tissues using anti-COTL1 antibody. Corresponding COTL1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Coactosin-like Protein 1/CotL1 Antibody [NBP2-48515] - Staining of human tonsil shows strong nuclear and cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-P, IP, PEP-ELISA
Jak2 [p Tyr1007, p
Tyr1008] Antibody (SY ...
NBP2-67429
Immunocytochemistry/Immunofluorescence: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Staining Phospho-JAK2(Y1007+Y1008) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Analysis of paraffin-embedded human tonsil tissue using anti-Phospho-JAK2(Y1007+Y1008) antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: Jak2 [p Tyr1007, p Tyr1008] Antibody (SY24-03) [NBP2-67429] - Analysis of paraffin-embedded human spleen tissue using anti-Phospho-JAK2(Y1007+Y1008) antibody. Counter stained with hematoxylin.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of Adenocarcinoma of Human ovary tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Western Blot: beta-Galactosidase-1/GLB1 Antibody (1C9) [NBP2-45731] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY GLB1.
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Whole cell extract (30 ug) was separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: Rad51 Antibody (14B4) [NB100-148] - staning of RAD51 nuclear foci in U2OS cells using RAD51 14B4 antibody. Cells were pre-extracted with CSK buffer before fixation with 4% PFA. RAD51 14B4 was used at 1:1000 dultion. DAPI was used to counterstain the nucleus. Scale bar, 10 mciro-meter.
Immunohistochemistry-Paraffin: Rad51 Antibody (14B4) [NB100-148] - Detects RAD51 in nucleus on BT483 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded BT483 xenograft. RAD51 antibody 14B4 at a dilution of 1:200.
(3 Reviews)
(38 Publications)
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and M1 mouse myeloid leukemia cell line. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for STAT5a at approximately 94 kDa and STAT5b at approximately 92 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
BaF3 mouse pro-B cell line treated with 10 ng/mL Recombinant Mouse IL‑3 (Catalog # 403-ML) for 1 hour was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. STAT5a/b/DNA complexes were immunoprecipitated using 5 μg Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) or control antibody (Catalog # AB-105-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Rabbit IgG Secondary Antibody (Catalog # BAF008). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The bcl-x promoter was detected by standard PCR.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5a/b at approximately 91 kDa (as indicated) using 20 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(8 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
STAT5b Antibody
[Unconjugated]
AF1584
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, M1 mouse myeloid leukemia cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for STAT5b at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
HeLa human cervical epithelial carcinoma and M1 mouse myeloid leukemia cell line were untreated (-) or activated (+) with 100 ng/mL Recombinant Human IFN‑ gamma (Catalog # 285-IF) for 15 minutes. STAT5b was immunoprecipitated from lysates of 5 x 106 cells following incubation with 2 µg Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) for 1 hour at room temperature. STAT5b-antibody complexes were absorbed using Protein A sepharose (Invitrogen, Catalog # 10-1041). Immunoprecipitated STAT5b was detected by Western blot using 1 µg/mL Human Phospho-STAT5a/b (Y699) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4190). View our recommended buffer recipes for immunoprecipitation.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5b at approximately 92 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
PIM3 Antibody
NBP1-50553
Western Blot: PIM3 Antibody [NBP1-50553] - Analysis of anti-PIM3 antibody with mouse kidney tissue lysate.
Immunohistochemistry-Paraffin: PIM3 Antibody [NBP1-50553] - Analysis of anti-PIM3 antibody with human spleen at concentration 10 ug/ml.
Species: Hu, Mu
Applications: WB, IHC-P
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Akt phosphorylated at S473 was detected in immersion fixed paraffin-embedded sections of human breast cancer tissue using Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
(18 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
STAT3 Antibody
(232209) [Unconjugate
MAB1799
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human STAT3 Monoclonal Antibody (Catalog # MAB1799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for STAT3 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
STAT3 was detected in immersion fixed HeLa human cervical epithelial carcinoma cell line using Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (Catalog # MAB1799) at 3 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm and nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
STAT3 was detected in immersion fixed HeLa human cervicalepithelial carcinoma cell line treated with IFN-alpha 1, but is not detected inSTAT3 knockout (KO) HeLa cell line using Mouse Anti-Human/Mouse/Rat STAT3Monoclonal Antibody (Catalog # MAB1799) at 1 µg/mL for 3 hours at roomtemperature. Cells were stained using the NorthernLights™ 557-conjugatedAnti-Mouse IgG Secondary Antibody (red; Catalog # NL007)and counterstained with DAPI (blue). Specific staining was localized tocytoplasm and nuclei. View our protocol for FluorescentICC Staining of Cells on Coverslips.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, IP, ICC, ICFlow, KO
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with scrambled control siRNA (lane 1) or Bcl-2 siRNA (lane2). Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - WB analysis of whole cell lysate (WCL) of Jurkat cells using anti-Bcl-2 antibody (NB100-56098) at 1:1000 dilution. HRP conjugated goat anti-rabbit IgG (H+L) cross adsorbed secondary antibody was used with ECL substrate for the detection of Bcl2 antibody bound to the blotted protein. This Bcl2 antibody detected a specific band at expected molecular weight marker position of Bcl2 protein (26kDa).
Immunohistochemistry-Paraffin: Bcl-2 Antibody [NB100-56098] - IHC analysis of a formalin-fixed paraffin-embedded (FFPE) human breast carcinoma tissue section using 1:1000 dilution of Bcl-2 antibody (NB100-56098) on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) with 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching using peroxide block. The sections were incubated with primary antibody for 30 minutes. Bond Polymer Refine Detection (Leica Biosystems) and DAB were used for signal detection which followed counterstaining with hematoxylin. Whole slide scanning and capturing of representative images (20X) were performed using Aperio AT2 (Leica Biosystems). This antibody generated a diffused cytoplasmic staining of BCL2 in the cancer cells with relatively intense signal in their nuclear membranes. Staining was performed by Histowiz.
(2 Reviews)
(6 Publications)
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
p21/CIP1/CDKN1A
Antibody (WA-1 (HJ21)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1 (HJ21)) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(11 Publications)
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
(1 Review)
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, Flow
LONP1 Antibody
NBP1-81734
LONP1 Antibody
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for LONP1 Antibody (NBP1-81734)(6)

We have publications tested in 2 confirmed species: Human, Drosophila.

We have publications tested in 1 application: WB.


Filter By Application
WB
(5)
All Applications
Filter By Species
Human
(3)
Drosophila
(2)
All Species
Showing Publications 1 - 6 of 6.
Publications using NBP1-81734 Applications Species
Pareek G, Thomas RE, Pallanck LJ. Loss of the Drosophila m-AAA mitochondrial protease paraplegin results in mitochondrial dysfunction, shortened lifespan, and neuronal and muscular degeneration. Cell Death Dis. 2018 Feb 21 [PMID: 29467464] (WB, Drosophila) WB Drosophila
Boutoual R, Meseguer S, Villarroya M et al. Defects in the mitochondrial-tRNA modification enzymes MTO1 and GTPBP3 promote different metabolic reprogramming through a HIF-PPARgamma-UCP2-AMPK axis Sci Rep 2018 Jan 18 [PMID: 29348686] (WB, Human) WB Human
Meseguer S, Boix O, Navarro-Gonzalez C et al. microRNA-mediated differential expression of TRMU, GTPBP3 and MTO1 in cell models of mitochondrial-DNA diseases Sci Rep 2017 Jul 24 [PMID: 28740091] (WB, Human) WB Human
Thomas RE, Andrews LA, Burman JL et al. PINK1-Parkin Pathway Activity Is Regulated by Degradation of PINK1 in the Mitochondrial Matrix. PLoS Genet. 2014 May 01 [PMID: 24874806] (WB, Drosophila)

Details:
Western blot analysis of Lon protease (Lon/LONP1 ) in whole head homogenate from control and Lon deficient Drosophila flies (Figure 1C) 		WB Drosophila
Jin SM, Youle RJ. The accumulation of misfolded proteins in the mitochondrial matrix is sensed by PINK1 to induce PARK2/Parkin-mediated mitophagy of polarized mitochondria. Autophagy 2013 Nov 1 [PMID: 24149988] (WB, Human) WB Human
Gozal YM, Duong DM, Gearing M et al. Proteomics analysis reveals novel components in the detergent-insoluble subproteome in Alzheimer's disease. J Proteome Res 2009 Nov [PMID: 19746990]

Reviews for LONP1 Antibody (NBP1-81734) (0)

There are no reviews for LONP1 Antibody (NBP1-81734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LONP1 Antibody (NBP1-81734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for LONP1 Antibody (NBP1-81734)

Discover related pathways, diseases and genes to LONP1 Antibody (NBP1-81734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LONP1 Antibody (NBP1-81734)

Discover more about diseases related to LONP1 Antibody (NBP1-81734).
 

Pathways for LONP1 Antibody (NBP1-81734)

View related products by pathway.

Blogs on LONP1

There are no specific blogs for LONP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LONP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LONP1