LONP1 Antibody - BSA Free

Images

 
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative ...read more
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left) , NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - PINK1 accumulates upon knockdown of Lon. Western blot analysis of Lon protease (Lon), Mitochondrial transcription factor A (TFAM), Heat shock ...read more
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).
Western Blot: LONP1 Antibody [NBP1-81734] - MTO1 defective cells exhibit proteostasis stress and an altered bioenergetic state. Representative immunoblot showing the expression of LONP1 in extracts of WT and MTO1 HF. ...read more
Western Blot: LONP1 Antibody [NBP1-81734] - Altered mitochondrial features in cybrid cells carrying MELAS, MERRF, m.5514 A > G (mt-tRNATrp), m.1643A > G (mt-tRNAVal), & m.14487 T > C (ND6) mutations. (A) ...read more

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, Mycoplasma
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free
Validated by:
     

Genetic Strategies

   

Order Details

View Available Formulations
Catalog# & Formulation Size Price

LONP1 Antibody - BSA Free Summary

Description
Novus Biologicals Rabbit LONP1 Antibody - BSA Free (NBP1-81734) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-LONP1 Antibody: Cited in 16 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LONP1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
See Simple Western Antibody Database for Simple Western validation: Tested in Human Kidney, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 110, 107 kDa
Control Peptide
LONP1 Recombinant Protein Antigen (NBP1-81734PEP)
Publications
Read Publications using
NBP1-81734 in the following applications:

  • KD
    1 publication
  • WB
    8 publications

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for LONP1 Antibody - BSA Free

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.53
  • hLON ATP-dependent protease
  • hLON
  • lon peptidase 1, mitochondrial
  • lon protease homolog, mitochondrial
  • Lon protease-like protein
  • LON
  • LonHS
  • LONP
  • Mitochondrial ATP-dependent protease Lon
  • mitochondrial lon peptidase 1
  • mitochondrial lon protease-like protein
  • PIM1
  • protease, serine, 15
  • PRSS15MGC1498
  • Serine protease 15

Background

LONP1 encodes a mitochondrial matrix protein in the Lon family of ATP-dependent proteases. A similar E. coli protein regulates gene expression by targeting specific regulatory proteins for degradation. This protein binds a specific sequence in the light and heavy chain promoters of the mitochondrial genome which are involved in regulation of DNA replication and transcription. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-73412
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-33434
Species: Hu
Applications: IHC,  IHC-P, WB
AF7865
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-32974
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
NBP3-42026
Species: Hu, Mu, Po, Rt
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-81734
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, Mycoplasma

Publications for LONP1 Antibody (NBP1-81734)(17)

We have publications tested in 3 confirmed species: Human, Mouse, Drosophila.

We have publications tested in 2 applications: KD, WB.


Filter By Application
KD
(1)
WB
(8)
All Applications
Filter By Species
Human
(7)
Mouse
(1)
Drosophila
(3)
All Species
Showing Publications 1 - 10 of 17. Show All 17 Publications.
Publications using NBP1-81734 Applications Species
Lane SL, Parks JC, Russ JE et al. Increased Systemic Antioxidant Power Ameliorates the Aging-Related Reduction in Oocyte Competence in Mice International Journal of Molecular Sciences 2021-12-01 [PMID: 34884824]
Di Rienzo M, Romagnoli A, Ciccosanti F Et al. AMBRA1 regulates mitophagy by interacting with ATAD3A and promoting PINK1 stability Autophagy 2021-11-19 [PMID: 34798798] (KD, Human) KD Human
Houston R, Sekine Y, Larsen MB et al. Discovery of bactericides as an acute mitochondrial membrane damage inducer Molecular Biology of the Cell 2021-11-01 [PMID: 34495738]
Burska D, Stiburek L, Krizova J et al. Homozygous missense mutation in UQCRC2 associated with severe encephalomyopathy, mitochondrial complex III assembly defect and activation of mitochondrial protein quality control Biochimica et biophysica acta. Molecular basis of disease 2021-04-15 [PMID: 33865955]
Lee YG, Kim HW, Nam Y et al. LONP1 and ClpP cooperatively regulate mitochondrial proteostasis for cancer cell survival Oncogenesis 2021-02-26 [PMID: 33637676] (Human) Human
Pareek G, Pallanck LJ. Inactivation of the mitochondrial protease Afg3l2 results in severely diminished respiratory chain activity and widespread defects in mitochondrial gene expression PLOS Genetics 2020-10-19 [PMID: 33075064]
Sekine S, Wang C, Sideris DP et al. Reciprocal Roles of Tom7 and OMA1 during Mitochondrial Import and Activation of PINK1 Mol. Cell 2019-01-23 [PMID: 30733118] (Human) Human
Trani G Characterization of patients with mitochondrial disease: assessment of the pathological phenotype associated with genes involved in mitochondrial quality control and dynamics. Thesis 2020-01-01 (WB, Human) WB Human
Sekine Y, Houston R, Eckl EM et al. A mitochondrial iron-responsive pathway regulated by DELE1 Molecular cell 2023-06-15 [PMID: 37327776]
Ishikawa K, Kobayashi K, Yamada A et al. Concentration of mitochondrial DNA mutations by cytoplasmic transfer from platelets to cultured mouse cells PLoS ONE 2019-03-04 [PMID: 30830936] (WB, Mouse) WB Mouse
Show All 17 Publications.

Reviews for LONP1 Antibody (NBP1-81734) (0)

There are no reviews for LONP1 Antibody (NBP1-81734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LONP1 Antibody (NBP1-81734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LONP1 Products

Research Areas for LONP1 Antibody (NBP1-81734)

Find related products by research area.

Blogs on LONP1

There are no specific blogs for LONP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LONP1 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol LONP1