LONP1 Antibody

Images

 
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative ...read more
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left) , NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Western Blot: LONP1 Antibody [NBP1-81734] - PINK1 accumulates upon knockdown of Lon. Western blot analysis of Lon protease (Lon), Mitochondrial transcription factor A (TFAM), Heat shock protein 60 (Hsp60) and Actin in ...read more
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

   

Order Details

LONP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LONP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in the literature (PMID:24874806). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
LONP1 Recombinant Protein Antigen (NBP1-81734PEP)
Publications
Read Publications using
NBP1-81734 in the following applications:

  • KD
    1 publication
  • WB
    8 publications

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LONP1 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.53
  • hLON ATP-dependent protease
  • hLON
  • lon peptidase 1, mitochondrial
  • lon protease homolog, mitochondrial
  • Lon protease-like protein
  • LON
  • LonHS
  • LONP
  • Mitochondrial ATP-dependent protease Lon
  • mitochondrial lon peptidase 1
  • mitochondrial lon protease-like protein
  • PIM1
  • protease, serine, 15
  • PRSS15MGC1498
  • Serine protease 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89557
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
NBP1-48002
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-02441
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
H00000810-M04
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
AF7865
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
NBP2-45731
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
AF1584
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
H00415116-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-81734
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for LONP1 Antibody (NBP1-81734)(13)

We have publications tested in 3 confirmed species: Human, Mouse, Drosophila.

We have publications tested in 2 applications: KD, WB.


Filter By Application
KD
(1)
WB
(8)
All Applications
Filter By Species
Human
(7)
Mouse
(1)
Drosophila
(3)
All Species
Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using NBP1-81734 Applications Species
Di Rienzo M, Romagnoli A, Ciccosanti F Et al. AMBRA1 regulates mitophagy by interacting with ATAD3A and promoting PINK1 stability Autophagy Nov 19 2021 [PMID: 34798798] (KD, Human) KD Human
Burska D, Stiburek L, Krizova J et al. Homozygous missense mutation in UQCRC2 associated with severe encephalomyopathy, mitochondrial complex III assembly defect and activation of mitochondrial protein quality control Biochimica et biophysica acta. Molecular basis of disease Apr 15 2021 [PMID: 33865955]
Ishikawa K, Kobayashi K, Yamada A et al. Concentration of mitochondrial DNA mutations by cytoplasmic transfer from platelets to cultured mouse cells PLoS ONE Mar 4 2019 [PMID: 30830936] (WB, Mouse) WB Mouse
Sekine S, Wang C, Sideris DP et al. Reciprocal Roles of Tom7 and OMA1 during Mitochondrial Import and Activation of PINK1 Mol. Cell Jan 23 2019 [PMID: 30733118] (Human) Human
Pareek G, Thomas RE, Vincow ES et al. Lon protease inactivation in Drosophila causes unfolded protein stress and inhibition of mitochondrial translation. Cell Death Discov. Oct 22 2018 [PMID: 30374414] (WB, Drosophila) WB Drosophila
Pareek G, Thomas RE, Pallanck LJ. Loss of the Drosophila m-AAA mitochondrial protease paraplegin results in mitochondrial dysfunction, shortened lifespan, and neuronal and muscular degeneration. Cell Death Dis. 2018 Feb 21 [PMID: 29467464] (WB, Drosophila) WB Drosophila
Boutoual R, Meseguer S, Villarroya M et al. Defects in the mitochondrial-tRNA modification enzymes MTO1 and GTPBP3 promote different metabolic reprogramming through a HIF-PPARgamma-UCP2-AMPK axis Sci Rep 2018 Jan 18 [PMID: 29348686] (WB, Human) WB Human
Meseguer S, Boix O, Navarro-Gonzalez C et al. microRNA-mediated differential expression of TRMU, GTPBP3 and MTO1 in cell models of mitochondrial-DNA diseases Sci Rep 2017 Jul 24 [PMID: 28740091] (WB, Human) WB Human
Thomas RE, Andrews LA, Burman JL et al. PINK1-Parkin Pathway Activity Is Regulated by Degradation of PINK1 in the Mitochondrial Matrix. PLoS Genet. 2014 May 01 [PMID: 24874806] (WB, Drosophila)

Details:
Western blot analysis of Lon protease (Lon/LONP1 ) in whole head homogenate from control and Lon deficient Drosophila flies (Figure 1C)
WB Drosophila
Jin SM, Youle RJ. The accumulation of misfolded proteins in the mitochondrial matrix is sensed by PINK1 to induce PARK2/Parkin-mediated mitophagy of polarized mitochondria. Autophagy 2013 Nov 1 [PMID: 24149988] (WB, Human) WB Human
Show All 13 Publications.

Reviews for LONP1 Antibody (NBP1-81734) (0)

There are no reviews for LONP1 Antibody (NBP1-81734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LONP1 Antibody (NBP1-81734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LONP1 Products

Bioinformatics Tool for LONP1 Antibody (NBP1-81734)

Discover related pathways, diseases and genes to LONP1 Antibody (NBP1-81734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LONP1 Antibody (NBP1-81734)

Discover more about diseases related to LONP1 Antibody (NBP1-81734).
 

Pathways for LONP1 Antibody (NBP1-81734)

View related products by pathway.

Blogs on LONP1

There are no specific blogs for LONP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LONP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LONP1