Home » LONP1 » LONP1 Antibodies » LONP1 Antibody

LONP1 Antibody

 (13 Publications)
 
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.
Genetic Strategies: Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-LONP1 antibody. Remaining relative ...read more
Simple Western: LONP1 Antibody [NBP1-81734] - Simple Western lane view shows a specific band for LONP1 in 0.2 mg/ml of h. Kidney (left) , NIH-3T3 (right) lysate. This experiment was performed under reducing conditions ...read more
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human duodenum shows granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human fallopian tube shows granular cytoplasmic positivity in glandular cells.
Western Blot: LONP1 Antibody [NBP1-81734] - PINK1 accumulates upon knockdown of Lon. Western blot analysis of Lon protease (Lon), Mitochondrial transcription factor A (TFAM), Heat shock protein 60 (Hsp60) and Actin in ...read more
Immunocytochemistry/ Immunofluorescence: LONP1 Antibody [NBP1-81734] - Staining of human cell line U-251 MG shows localization to nucleoplasm & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human tonsil shows granular cytoplasmic positivity.
Western Blot: LONP1 Antibody [NBP1-81734] - Analysis in mouse cell line NIH-3T3, rat cell line NBT-II and rat cell line pC12.
Immunohistochemistry-Paraffin: LONP1 Antibody [NBP1-81734] - Staining of human pancreas shows granular cytoplasmic positivity.
Simple Western: LONP1 Antibody [NBP1-81734] - Electropherogram image(s) of corresponding Simple Western lane view. LONP1 antibody was used at 1:20 dilution on h. Kidney and NIH-3T3 lysate(s).

Product Details

Summary
Reactivity Hu, Mu, Rt, DrSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P, KD
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
     

Genetic Strategies

    

Order Details

100% Guarantee on every product

LONP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VEEKIKQTHRKYLLQEQLKIIKKELGLEKDDKDAIEEKFRERLKELVVPKHVMDVVDEELSKLGLLDNHSSEFNVTRNYLDWLTSIPWGKYSNENLDLARAQAVLEEDHYGMEDVKKRILEFIAVSQLRGSTQGKILCFYGP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LONP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04-0.4 ug/ml
Application Notes
WB reported in the literature (PMID:24874806). ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended.
Control Peptide
LONP1 Recombinant Protein Antigen (NBP1-81734PEP)
Publications
Read Publications using
NBP1-81734 in the following applications:

  • KD
    1 publication
  • WB
    8 publications

Reactivity Notes

Drosophila reactivity reported in scientific literature (PMID: 29467464).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for LONP1 Antibody

  • EC 3.4.21
  • EC 3.4.21.-
  • EC 3.4.21.53
  • hLON ATP-dependent protease
  • hLON
  • lon peptidase 1, mitochondrial
  • lon protease homolog, mitochondrial
  • Lon protease-like protein
  • LON
  • LonHS
  • LONP
  • Mitochondrial ATP-dependent protease Lon
  • mitochondrial lon peptidase 1
  • mitochondrial lon protease-like protein
  • PIM1
  • protease, serine, 15
  • PRSS15MGC1498
  • Serine protease 15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CLPP Antibody
NBP1-89557
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: CLPP Antibody [NBP1-89557] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, KD, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on U-937 cells with c-Myc Antibody (9E10) NB600-302AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow Cytometry: c-Myc Antibody (9E10) [NB600-302] - An intracellular stain was performed on Jurkat cells with c-Myc Antibody (9E10) NB600-302R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to DyLight 550.
Western Blot: c-Myc Antibody (9E10) [NB600-302] - CtIP is phosphorylated by CDKs at multiple sites. Myc-BRCA1 and/or HA-CtIP WT or indicated mutants were expressed in 293T cells and co-immunoprecipitation was performed. Image collected and cropped by CiteAb from the following publication (//doi.org/10.1371/journal.pgen.1003277) licensed under a CC-BY licence.
(4 Reviews)
(38 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
SSB Antibody
(OTI2C8)
NBP1-48002
Western Blot: SSB Antibody (OTI2C8) [NBP1-48002] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SSB (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SSB.
Immunohistochemistry-Paraffin: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of paraffin-embedded Adenocarcinoma of Human colon tissue using anti-SSB mouse monoclonal antibody.
Immunohistochemistry-Paraffin: SSB Antibody (OTI2C8) [NBP1-48002] - Staining of paraffin-embedded Carcinoma of Human lung tissue using anti-SSB mouse monoclonal antibody.
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
PIM2 Antibody
(OTI5D5)
NBP2-02441
Flow Cytometry: PIM2 Antibody (OTI5D5) [NBP2-02441] - Analysis of Jurkat cells, using anti-PIM2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: PIM2 Antibody (OTI5D5) [NBP2-02441] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-PIM2 antibody, and then analyzed by flow cytometry.
Western Blot: PIM2 Antibody (OTI5D5) [NBP2-02441] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PIM2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-PIM2.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
HSP60 Antibody -
BSA Free
NBP1-77397
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 1 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody [NBP1-77397] - HeLa cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody conjugated to Alexa Fluor 488 (NBP1-77397AF488) at 5 ug/ml for 1 hour at room temperature. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
Immunocytochemistry/Immunofluorescence: HSP60 Antibody - BSA Free [NBP1-77397] - Mouse MS1 cells were fixed in 4% paraformaldehyde for 10 minutes and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with HSP60 Antibody (NBP1-77397) at 2ug/ml overnight at 4C and detected with an anti-rabbit DyLight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective and digitally deconvolved.
(4 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
CALML3 Antibody
(2A11)
H00000810-M04
Western Blot: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of CALML3 expression in transfected 293T cell line by CALML3 monoclonal antibody (M04), clone 2A11. Lane 1: CALML3 transfected lysatE (16.9 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of monoclonal antibody to CALML3 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: CALML3 Antibody (2A11) [H00000810-M04] - Analysis of monoclonal antibody to CALML3 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 12 ug/ml
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Coactosin-like
Protein 1/CotL1 Antib
AF7865
Western blot shows lysates of JAR human choriocarcinoma cell line, NCI‑H345 human small cell lung carcinoma cell line, human placenta tissue, and rat placenta tissue. PVDF membrane was probed with 1 µg/mL of Sheep Anti-Human/Mouse/Rat Coactosin-like Protein 1/COTL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7865) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Coactosin-like Protein 1/COTL1 at approximately 15 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Coactosin-like Protein 1/COTL1 was detected in immersion fixed NCI‑H128 human small cell lung carcinoma cell line using Sheep Anti-Human/Mouse/Rat Coactosin-like Protein 1/COTL1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7865) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Non-adherent Cells.
Species: Hu, Mu, Rt
Applications: ICC, WB
CSRP3 Antibody
NBP1-06983
Western Blot: CSRP3 Antibody [NBP1-06983] - (0.01ug/ml) staining of Human (A), Mouse (B) and Rat (C) Heart lysate (35ug protein in RIPA buffer). Detected by chemiluminescence.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - Staining of paraffin embedded Human Skeletal Muscle. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Immunohistochemistry-Paraffin: CSRP3 Antibody [NBP1-06983] - staining of paraffin embedded Human Heart. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
Jak2 Antibody
(53B7) - BSA Free
NBP2-59451
Flow Cytometry: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cell line, antibody at 2 - 5 ug per 10^6cells (red line). Secondary antibody: goat anti-mouse IgG Alexa Fluor 488 conjugate. Isotype control antibody: mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: Jak2 Antibody (53B7) [NBP2-59451] - Analysis of JAK2 in HeLa cells line, stained with DAPI (Blue) and anti-human JAK2 antibody at 1:100 with goat anti-mouse IgG Alexa Fluor 488 conjugate (Green).
Western Blot: Jak2 Antibody (53B7) [NBP2-59451] - Human breast cancer MCF7 cells were treated with control (Con) or Adenosine (Ado) and the expression of JAK2 was detected. Western blot image submitted by a verified customer review.
(3 Reviews)
(1 Publication)
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB

beta-Galactosidase-1/G ...
NBP2-45731
Western Blot: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of extracts (35ug) from 9 different cell lines by using anti-GLB1 monoclonal antibody (HepG2: human; HeLa: human; SVT2: mouse; A549: human; COS7: monkey; Jurkat: human; MDCK: canine; PC12: rat; MCF7: human).
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Carcinoma of Human pancreas tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
Immunohistochemistry: beta-Galactosidase-1/GLB1 Antibody (OTI1C9) [NBP2-45731] - Analysis of Human liver tissue. (Heat-induced epitope retrieval by 10mM citric buffer, pH6.0, 120C for 3min)
(7 Publications)
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Rad51 Antibody
(14B4)
NB100-148
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouset IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Western Blot: Rad51 Antibody (14B4) [NB100-148] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Rad51 antibody [14B4] diluted at 1:500. The HRP-conjugated anti-mouse IgG antibody (NBP2-19382) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
(5 Reviews)
(57 Publications)
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
STAT5a/b Antibody
[Unconjugated] - Pan ...
AF2168
Western blot shows lysates of K562 human chronic myelogenous leukemia cell line and M1 mouse myeloid leukemia cell line. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). Specific bands were detected for STAT5a at approximately 94 kDa and STAT5b at approximately 92 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and K562 human chronic myelogenous leukemia cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5a/b at approximately 91 kDa (as indicated) using 20 µg/mL of Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
BaF3 mouse pro-B cell line treated with 10 ng/mL Recombinant Mouse IL‑3 (Catalog # 403-ML) for 1 hour was fixed using formaldehyde, resuspended in lysis buffer, and sonicated to shear chromatin. STAT5a/b/DNA complexes were immunoprecipitated using 5 μg Rabbit Anti-Human/Mouse STAT5a/b Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2168) or control antibody (Catalog # AB-105-C) for 15 minutes in an ultrasonic bath, followed by Biotinylated Anti-Rabbit IgG Secondary Antibody (Catalog # BAF008). Immunocomplexes were captured using 50 μL of MagCellect Streptavidin Ferrofluid (Catalog # MAG999) and DNA was purified using chelating resin solution. The bcl-x promoter was detected by standard PCR.
(1 Review)
(14 Publications)
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
STAT5b Antibody
[Unconjugated]
AF1584
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line, Daudi human Burkitt's lymphoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, M1 mouse myeloid leukemia cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for STAT5b at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of HeLa human cervical epithelial carcinoma cell line and NIH‑3T3 mouse embryonic fibroblast cell line, loaded at 0.2 mg/mL. A specific band was detected for STAT5b at approximately 92 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and STAT5b knockout HeLa cell line (KO). PVDF membrane was probed with 0.2 µg/mL of Rabbit Anti-Human/Mouse STAT5b Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1584) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for STAT5b at approximately 90 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockoutHeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(3 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Recombinant Human
PIM3 GST (N-Term) Pro ...
H00415116-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
Applications: ELISA, AP, PA, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(27 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
STAT3 Antibody
(232209) [Unconjugate
MAB1799
STAT3 was detected in immersion fixed HeLa human cervicalepithelial carcinoma cell line treated with IFN-alpha 1, but is not detected inSTAT3 knockout (KO) HeLa cell line using Mouse Anti-Human/Mouse/Rat STAT3Monoclonal Antibody (Catalog # MAB1799) at 1 µg/mL for 3 hours at roomtemperature. Cells were stained using the NorthernLights™ 557-conjugatedAnti-Mouse IgG Secondary Antibody (red; Catalog # NL007)and counterstained with DAPI (blue). Specific staining was localized tocytoplasm and nuclei. View our protocol for FluorescentICC Staining of Cells on Coverslips.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, HeLa human cervical epithelial carcinoma cell line, NIH‑3T3 mouse embryonic fibroblast cell line, and PC‑12 rat adrenal pheochromocytoma cell line. PVDF membrane was probed with 0.1 µg/mL of Mouse Anti-Human STAT3 Monoclonal Antibody (Catalog # MAB1799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for STAT3 at approximately 90 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line, STAT1 knockout (KO) HeLa cell line, STAT2 KO HeLa cell line, STAT3 KO HeLa cell line, STAT5a KO HeLa cell line, STAT5b KO HeLa cell line, STAT6 KO HeLa cell line,. PVDF membrane was probed with 0.5 µg/mL of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (Catalog # MAB1799) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for STAT3 at approximately 80 kDa (as indicated) in the parental HeLacell line, but is not detectable in the STAT3 knockout HeLa cell line. GAPDH(Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(14 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PU.1/Spi-1 Antibody
NBP2-27163
Western Blot: PU.1/Spi1 Antibody [NBP2-27163] - analysis of 293T cell lysate (30ug) using anti-PU.1/Spi1 antibody. Image from verified customer review.
Western Blot: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Analysis of PU.1/Spi1 in U937 cell lysate in the 1) absence and 2) presence of immunizing peptide using NBP2-27163.
Flow Cytometry: PU.1/Spi-1 Antibody [NBP2-27163] - PU.1/Spi1 Antibody [NBP2-27163] - Intracellular analysis of PU.1 in mouse RAW cells (top) and PMA treated (20 ng/ml, overnight) human ThP1 cells (bottom) using 1.25 ug/10^6 cells. Green peak represents isotype control this antibody ; red represents anti-PU.1 antibody.
(1 Review)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
LONP1 Antibody
NBP1-81734
LONP1 Antibody
Species: Hu, Mu, Rt, Dr
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD

Publications for LONP1 Antibody (NBP1-81734)(13)

We have publications tested in 3 confirmed species: Human, Mouse, Drosophila.

We have publications tested in 2 applications: KD, WB.


Filter By Application
KD
(1)
WB
(8)
All Applications
Filter By Species
Human
(7)
Mouse
(1)
Drosophila
(3)
All Species
Showing Publications 1 - 10 of 13. Show All 13 Publications.
Publications using NBP1-81734 Applications Species
Di Rienzo M, Romagnoli A, Ciccosanti F Et al. AMBRA1 regulates mitophagy by interacting with ATAD3A and promoting PINK1 stability Autophagy Nov 19 2021 [PMID: 34798798] (KD, Human) KD Human
Burska D, Stiburek L, Krizova J et al. Homozygous missense mutation in UQCRC2 associated with severe encephalomyopathy, mitochondrial complex III assembly defect and activation of mitochondrial protein quality control Biochimica et biophysica acta. Molecular basis of disease Apr 15 2021 [PMID: 33865955]
Ishikawa K, Kobayashi K, Yamada A et al. Concentration of mitochondrial DNA mutations by cytoplasmic transfer from platelets to cultured mouse cells PLoS ONE Mar 4 2019 [PMID: 30830936] (WB, Mouse) WB Mouse
Sekine S, Wang C, Sideris DP et al. Reciprocal Roles of Tom7 and OMA1 during Mitochondrial Import and Activation of PINK1 Mol. Cell Jan 23 2019 [PMID: 30733118] (Human) Human
Pareek G, Thomas RE, Vincow ES et al. Lon protease inactivation in Drosophila causes unfolded protein stress and inhibition of mitochondrial translation. Cell Death Discov. Oct 22 2018 [PMID: 30374414] (WB, Drosophila) WB Drosophila
Pareek G, Thomas RE, Pallanck LJ. Loss of the Drosophila m-AAA mitochondrial protease paraplegin results in mitochondrial dysfunction, shortened lifespan, and neuronal and muscular degeneration. Cell Death Dis. 2018 Feb 21 [PMID: 29467464] (WB, Drosophila) WB Drosophila
Boutoual R, Meseguer S, Villarroya M et al. Defects in the mitochondrial-tRNA modification enzymes MTO1 and GTPBP3 promote different metabolic reprogramming through a HIF-PPARgamma-UCP2-AMPK axis Sci Rep 2018 Jan 18 [PMID: 29348686] (WB, Human) WB Human
Meseguer S, Boix O, Navarro-Gonzalez C et al. microRNA-mediated differential expression of TRMU, GTPBP3 and MTO1 in cell models of mitochondrial-DNA diseases Sci Rep 2017 Jul 24 [PMID: 28740091] (WB, Human) WB Human
Thomas RE, Andrews LA, Burman JL et al. PINK1-Parkin Pathway Activity Is Regulated by Degradation of PINK1 in the Mitochondrial Matrix. PLoS Genet. 2014 May 01 [PMID: 24874806] (WB, Drosophila)

Details:
Western blot analysis of Lon protease (Lon/LONP1 ) in whole head homogenate from control and Lon deficient Drosophila flies (Figure 1C) 		WB Drosophila
Jin SM, Youle RJ. The accumulation of misfolded proteins in the mitochondrial matrix is sensed by PINK1 to induce PARK2/Parkin-mediated mitophagy of polarized mitochondria. Autophagy 2013 Nov 1 [PMID: 24149988] (WB, Human) WB Human
Show All 13 Publications.

Reviews for LONP1 Antibody (NBP1-81734) (0)

There are no reviews for LONP1 Antibody (NBP1-81734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for LONP1 Antibody (NBP1-81734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional LONP1 Products

Bioinformatics Tool for LONP1 Antibody (NBP1-81734)

Discover related pathways, diseases and genes to LONP1 Antibody (NBP1-81734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for LONP1 Antibody (NBP1-81734)

Discover more about diseases related to LONP1 Antibody (NBP1-81734).
 

Pathways for LONP1 Antibody (NBP1-81734)

View related products by pathway.

Blogs on LONP1

There are no specific blogs for LONP1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our LONP1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol LONP1