Independent Antibodies: Western Blot: SNX1 Antibody [NBP2-56957] - Analysis using Anti-SNX1 antibody NBP2-56957 (A) shows similar pattern to independent antibody NBP2-13359 (B).
Immunocytochemistry/ Immunofluorescence: SNX1 Antibody [NBP2-56957] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.
A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate ...read more
A pool of SNX1-positive membranes at vicinity of nascent autophagosomes.(A) Time-lapse images of HeLa cells expressing SNX1-GFP and DCFP1-RFP under starved conditions (stv., 15 min). Arrowheads indicate ...read more
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYE
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SNX1 Antibody - BSA Free
HsT17379
MGC8664
SNX1Asorting nexin 1A
sorting nexin 1
sorting nexin-1
Vps5
Background
SNX1 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SNX1 Antibody - BSA Free and receive a gift card or discount.