SNX1 Antibody - BSA Free

Western Blot: SNX1 Antibody [NBP2-56957] - Analysis using Anti-SNX1 antibody NBP2-56957 (A) shows similar pattern to independent antibody NBP2-13359 (B).

Immunocytochemistry/Immunofluorescence: SNX1 Antibody [NBP2-56957] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

• Reactivity: Hu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SNX1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SNX1 Antibody - BSA Free (NBP2-56957) is a polyclonal antibody validated for use in WB and ICC/IF. Anti-SNX1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: NNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLAKTLISLPPQEATNSSKPQPTYE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SNX1 Recombinant Protein Antigen (NBP2-56957PEP)

Reactivity Notes

Mouse 84%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SNX1 Antibody - BSA Free

• HsT17379
• MGC8664
• SNX1Asorting nexin 1A
• sorting nexin 1
• sorting nexin-1
• Vps5

Background

SNX1 encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This endosomal protein regulates the cell-surface expression of epidermal growth factor receptor. This protein also has a role in sorting protease-activated receptor-1 from early endosomes to lysosomes. This protein may form oligomeric complexes with family members. This gene results in three transcript variants encoding distinct isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SNX1 Antibody (NBP2-56957)(2)

Publications using NBP2-56957

• Da GraCa J, Charles J, Djebar M et al. A SNX1-SNX2-VAPB partnership regulates endosomal membrane rewiring in response to nutritional stress Life science alliance 2023-03-01 [PMID: 36585258] (WB, ICC/IF, Human)
• Da GraCa J, Charles J, Djebar M et al. A SNX1-SNX2-VAPB partnership regulates endosomal membrane rewiring in response to nutritional stress Life science alliance 2023-03-01 [PMID: 36585258] (WB, ICC/IF, Human)

Bioinformatics

• Gene Symbol: SNX1