RP9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: RP9 Antibody [NBP1-87342] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol.
Immunohistochemistry-Paraffin: RP9 Antibody [NBP1-87342] - Staining of human hippocampus shows nuclear positivity in glial cells and neurons.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RP9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEQELQRRREQKRRRHDAQQLQQLKHLESFYEKPPPGLIKEDETKPEDCIPDVPGNEHAREFLAHAPTKGLWM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RP9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RP9 Protein (NBP1-87342PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RP9 Antibody

  • PAP-1Pim-1-associated protein
  • Pim-1 kinase associated protein
  • retinitis pigmentosa 9 (autosomal dominant)
  • retinitis pigmentosa 9 protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-22273
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP1-83219
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003738-M01
Species: Hu
Applications: WB, ELISA
NBP1-82510
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31366
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81734
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
H00005545-R02
Species: Hu
NB110-57150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-00714
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF8554
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-87342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for RP9 Antibody (NBP1-87342) (0)

There are no publications for RP9 Antibody (NBP1-87342).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RP9 Antibody (NBP1-87342) (0)

There are no reviews for RP9 Antibody (NBP1-87342). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for RP9 Antibody (NBP1-87342) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RP9 Products

RP9 NBP1-87342

Bioinformatics Tool for RP9 Antibody (NBP1-87342)

Discover related pathways, diseases and genes to RP9 Antibody (NBP1-87342). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RP9 Antibody (NBP1-87342)

Discover more about diseases related to RP9 Antibody (NBP1-87342).
 

Pathways for RP9 Antibody (NBP1-87342)

View related products by pathway.

PTMs for RP9 Antibody (NBP1-87342)

Learn more about PTMs related to RP9 Antibody (NBP1-87342).

Blogs on RP9

There are no specific blogs for RP9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RP9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RP9