SNRNP27 Antibody

Images

 
Western Blot: SNRNP27 Antibody [NBP1-80808] - Analysis in control (vector only transfected HEK293T lysate) and SNRNP27 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: SNRNP27 Antibody [NBP1-80808] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: SNRNP27 Antibody [NBP1-80808] - Staining of human gall bladder shows strong nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SNRNP27 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TSPSPSRLKERRDEEKKETKETKSKERQITEEDLEGKTEEEIEMMKLMGFASFDSTKGKKVDGSVNAYAINVSQKRKYRQYMNRKGGFNR
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SNRNP27
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SNRNP27 Protein (NBP1-80808PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SNRNP27 Antibody

  • Nucleic acid-binding protein RY-1
  • putative nucleic acid binding protein RY-1
  • RY1,27K
  • small nuclear ribonucleoprotein 27kDa (U4/U6.U5)
  • U4/U6.U5 small nuclear ribonucleoprotein 27 kDa protein
  • U4/U6.U5 snRNP 27 kDa protein
  • U4/U6.U5 tri-snRNP-associated 27 kDa protein
  • U4/U6.U5 tri-snRNP-associated protein 3
  • U4/U6.U5-27K

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1445
Species: Mu, Rt
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB4470
Species: All-Multi
Applications: WB, IHC, ICC
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37322
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
H00005087-M01
Species: Hu, Mu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA
H00010713-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-89025
Species: Hu, Rt, Po, Ca, Ch, Ha, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37447
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, IF
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
H00007536-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-90949
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB

Publications for SNRNP27 Antibody (NBP1-80808) (0)

There are no publications for SNRNP27 Antibody (NBP1-80808).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SNRNP27 Antibody (NBP1-80808) (0)

There are no reviews for SNRNP27 Antibody (NBP1-80808). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for SNRNP27 Antibody (NBP1-80808) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SNRNP27 Products

Bioinformatics Tool for SNRNP27 Antibody (NBP1-80808)

Discover related pathways, diseases and genes to SNRNP27 Antibody (NBP1-80808). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for SNRNP27 Antibody (NBP1-80808)

View related products by pathway.

Blogs on SNRNP27

There are no specific blogs for SNRNP27, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SNRNP27 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SNRNP27
Entrez