SMN Antibody

Images

 
Western Blot: SMN Antibody [NBP2-46712] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10, Lane 2: Human cell line RT-4
Immunohistochemistry-Paraffin: SMN Antibody [NBP2-46712] - Staining of human gallbladder shows nuclear positivity in glandular cells.
Immunohistochemistry: SMN Antibody [NBP2-46712] - Staining of human cerebral cortex shows strong nuclear positivity in neuronal cells and subset of glial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: EDSVLFRRGTGQSDDSDIWDDTALIKAYDKAVASFKHALKNGDICETSGKPKTTPKRKPAKKNKSQKKNTAASLQQWKVGDKCSAIWSEDGCIYP
Specificity
Specificity of human SMN antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SMN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SMN Recombinant Protein Antigen (NBP2-46712PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (87%), Rat (85%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SMN Antibody

  • Gemin-1
  • Kugelberg-Welander disease)
  • SMNC
  • survival motor neuron protein
  • survival of motor neuron 1, telomeric

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
MAB829
Species: Hu
Applications: WB, IHC
NBP1-77177
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, ICC, IF
NBP1-84058
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP2-20324
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24740
Species: Hu, Mu, Bv, Ca, Eq, Pm
Applications: WB, IHC-P
NBP2-57100
Species: Hu
Applications: ICC/IF
NBP2-62651
Species: Hu
Applications: WB, IHC, IHC-P
AF1436
Species: Mu
Applications: WB
NB100-55266
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-269
Species: Hu, Mu, Rt, Po, Bv, Ch, Dr, Eq, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56841
Species: Hu
Applications: WB, ICC/IF

Publications for SMN Antibody (NBP2-46712) (0)

There are no publications for SMN Antibody (NBP2-46712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMN Antibody (NBP2-46712) (0)

There are no reviews for SMN Antibody (NBP2-46712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SMN Antibody (NBP2-46712). (Showing 1 - 1 of 1 FAQ).

  1. Could you recommond the Human specific SMN antibody? It will only recognize human SMN, without cross reaction with mouse smn.
    • We do not have an SMN antibody that has been validated NOT to work in mouse samples. When an antibody is found to not react with a certain species, we mark the data sheet with a (-) next to the species' name. Unfortunately, the SMN antibodies that do not list mouse have not been tested in mouse, and may react.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SMN Antibody (NBP2-46712)

Discover related pathways, diseases and genes to SMN Antibody (NBP2-46712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMN Antibody (NBP2-46712)

Discover more about diseases related to SMN Antibody (NBP2-46712).
 

Pathways for SMN Antibody (NBP2-46712)

View related products by pathway.

PTMs for SMN Antibody (NBP2-46712)

Learn more about PTMs related to SMN Antibody (NBP2-46712).
 

Research Areas for SMN Antibody (NBP2-46712)

Find related products by research area.

Blogs on SMN

There are no specific blogs for SMN, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMN Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SMN1
Entrez
Uniprot