SMCX Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SMCX Antibody [NBP2-55009] - Staining of human cell line HEK 293 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SMCX Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSHSPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRG
Specificity
Specificity of human SMCX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (91%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KDM5C
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SMCX Recombinant Protein Antigen (NBP2-55009PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for SMCX Antibody

  • DXS1272EMRXJ
  • EC 1.14.11
  • EC 1.14.11.-
  • Histone demethylase JARID1C
  • JARID1Clysine-specific demethylase 5C
  • Jumonji, AT rich interactive domain 1C (RBP2-like)
  • jumonji, AT rich interactive domain 1C
  • Jumonji/ARID domain-containing protein 1C
  • lysine (K)-specific demethylase 5C
  • MRXSJ
  • Protein SmcX
  • Protein Xe169
  • Smcx homolog, X chromosome
  • SMCXselected cDNA on X
  • Smcy homolog, X-linked (mouse)
  • Smcy homolog, X-linked
  • XE169JmjC domain-containing protein SMCX

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

22240002
Species: Hu
Applications: WB, ELISA
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NB110-40499
Species: Hu, Mu
Applications: WB, IP
NB100-97821
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP
NBP1-80628
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-88941
Species: Hu
Applications: IHC, IHC-P
NBP1-87691
Species: Hu
Applications: WB, IHC, IHC-P
NB100-81657
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
NB100-41384
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, PEP-ELISA, S-ELISA
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-1762
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
NBP2-67451
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-94118
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-204
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB300-104
Species: Hu, Mu, Rt, Gp, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NBP1-85464
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80582
Species: Hu
Applications: IHC, IHC-P
NBP2-55009
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for SMCX Antibody (NBP2-55009) (0)

There are no publications for SMCX Antibody (NBP2-55009).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SMCX Antibody (NBP2-55009) (0)

There are no reviews for SMCX Antibody (NBP2-55009). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SMCX Antibody (NBP2-55009) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SMCX Products

Array NBP2-55009

Bioinformatics Tool for SMCX Antibody (NBP2-55009)

Discover related pathways, diseases and genes to SMCX Antibody (NBP2-55009). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SMCX Antibody (NBP2-55009)

Discover more about diseases related to SMCX Antibody (NBP2-55009).
 

Pathways for SMCX Antibody (NBP2-55009)

View related products by pathway.

PTMs for SMCX Antibody (NBP2-55009)

Learn more about PTMs related to SMCX Antibody (NBP2-55009).

Blogs on SMCX

There are no specific blogs for SMCX, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SMCX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KDM5C