RBP2 Antibody

Images

 
Western Blot: RBP2 Antibody [NBP1-85464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: RBP2 Antibody [NBP1-85464] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunocytochemistry/ Immunofluorescence: RBP2 Antibody [NBP1-85464] - Staining of human cell line A-431 shows positivity in golgi apparatus.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RBP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBP2 Protein (NBP1-85464PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RBP2 Antibody

  • Cellular retinol-binding protein II
  • cellular
  • CRABP-II
  • CRBP2CRBP-II
  • retinol binding protein 2, cellular

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-539
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB110-40499
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-26616
Species: Hu
Applications: WB, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-58922
Species: Hu
Applications: WB
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB110-41487
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
NBP1-87695
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-47314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
NBP2-27073
Species: Hu, Mu, Bv, Eq, Op, Pm
Applications: WB, IHC-P

Publications for RBP2 Antibody (NBP1-85464) (0)

There are no publications for RBP2 Antibody (NBP1-85464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP2 Antibody (NBP1-85464) (0)

There are no reviews for RBP2 Antibody (NBP1-85464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBP2 Antibody (NBP1-85464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RBP2 Products

Bioinformatics Tool for RBP2 Antibody (NBP1-85464)

Discover related pathways, diseases and genes to RBP2 Antibody (NBP1-85464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP2 Antibody (NBP1-85464)

Discover more about diseases related to RBP2 Antibody (NBP1-85464).
 

Pathways for RBP2 Antibody (NBP1-85464)

View related products by pathway.

PTMs for RBP2 Antibody (NBP1-85464)

Learn more about PTMs related to RBP2 Antibody (NBP1-85464).

Blogs on RBP2

There are no specific blogs for RBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RBP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RBP2