RBP2 Antibody


Western Blot: RBP2 Antibody [NBP1-85464] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunocytochemistry/ Immunofluorescence: RBP2 Antibody [NBP1-85464] - Immunofluorescent staining of human cell line CACO-2 shows localization to the Golgi apparatus.
Orthogonal Strategies: Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining in human duodenum and liver tissues using anti-RBP2 antibody. Corresponding RBP2 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human duodenum shows high expression.
Immunohistochemistry-Paraffin: RBP2 Antibody [NBP1-85464] - Staining of human liver shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

RBP2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVC
Specificity of human RBP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
RBP2 Protein (NBP1-85464PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (85%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for RBP2 Antibody

  • Cellular retinol-binding protein II
  • cellular
  • retinol binding protein 2, cellular


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Ch, Fe, Pm, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, Simple Western, IHC

Publications for RBP2 Antibody (NBP1-85464) (0)

There are no publications for RBP2 Antibody (NBP1-85464).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for RBP2 Antibody (NBP1-85464) (0)

There are no reviews for RBP2 Antibody (NBP1-85464). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RBP2 Antibody (NBP1-85464) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional RBP2 Products

Bioinformatics Tool for RBP2 Antibody (NBP1-85464)

Discover related pathways, diseases and genes to RBP2 Antibody (NBP1-85464). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for RBP2 Antibody (NBP1-85464)

Discover more about diseases related to RBP2 Antibody (NBP1-85464).

Pathways for RBP2 Antibody (NBP1-85464)

View related products by pathway.

PTMs for RBP2 Antibody (NBP1-85464)

Learn more about PTMs related to RBP2 Antibody (NBP1-85464).

Blogs on RBP2

There are no specific blogs for RBP2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our RBP2 Antibody and receive a gift card or discount.


Gene Symbol RBP2