Home » SAP102 » SAP102 Antibodies » SAP102 Antibody

SAP102 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human tonsil shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SAP102 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SAP102 Protein (NBP1-87691PEP)
Publications
Read Publication using NBP1-87691.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19167192)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAP102 Antibody

  • discs, large homolog 3 (Drosophila)
  • KIAA1232discs, large homolog 3 (neuroendocrine-dlg, Drosophila)
  • MRX90MRX
  • NEDLGdisks large homolog 3
  • neuroendocrine-DLG
  • SAP-102
  • SAP102NE-Dlg
  • Synapse-associated protein 102
  • XLMR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DLG1 Antibody
NB600-1229
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of NIH-3T3 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Western Blot: DLG1 Antibody [NB600-1229] - Analysis of 25 ug of C6 (lane 1), PC12 (lane 2) and rat brain (lane 3) cell lysates.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(25 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
PSD-95 Antibody
(6G6-1C9) - BSA Free
NB300-556
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Immunocytochemistry/Immunofluorescence: PSD-95 Antibody (6G6-1C9) [NB300-556] - Control immunolocalization of plasma membrane AMPA receptor subunits (external epitopes) in hippocampal neuronal cultures. H) Immunolabeling of non-permeabilized neuronal cultures with ani-GluA1 (green). (I) Immunolabeling with the postsynaptic marker anti-PSD95 [66] after permeabilization of neuronal cultures. (J) Merging of (H) and (I) showing postsynaptic labeling of GluA1. Scale bar (valid for all images): 10 um. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0140868), licensed under a CC-BY licence.
(1 Review)
(25 Publications)
Species: Hu, In, Mu, Pm, Rt
Applications: B/N, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Hela cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - Analysis of Jurkat cells, using anti-Guanylate kinase antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
PSD93 Antibody
(S18-30)
NBP2-12912
Immunocytochemistry/Immunofluorescence: PSD93 Antibody (S18-30) [NBP2-12912] - Tissue: SK-N-BE Cells (Human Neuroblastoma cells). Species: Human. Fixation: 4% Formaldehyde for 15 min at RT. Primary Antibody: Mouse Anti-Chapsyn-110 Monoclonal Antibody at 1:100 for 60 min at RT. Secondary Antibody: Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain: Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1000, 1:5000 for 60 min at RT, 5 min at RT. Localization: Membrane, Cell Junction, Synapse, Postsynaptic Cell Membrane. Magnification: 60X.
Western Blot: PSD93 Antibody (S18-30) [NBP2-12912] - analysis of Rat brain membrane lysate showing detection of Chapsyn-110 protein using Mouse Anti-Chapsyn-110 Monoclonal Antibody, Clone S18-30 . Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Chapsyn-110 Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Rad50 Antibody
(13B3)
NB100-147
Immunohistochemistry-Paraffin: Rad50 Antibody (13B3) [NB100-147] - Human lung cancer. Rad50 stained by Rad50 antibody [13B3] diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Immunohistochemistry-Paraffin: Rad50 Antibody (13B3) [NB100-147] - Human lung cancer. Rad50 stained by Rad50 antibody [13B3] diluted at 1:100.Antigen Retrieval: Citrate buffer, pH 6.0, 15 min
Western Blot: Rad50 Antibody (13B3) [NB100-147] - Analysis of RAD50 in 293T cell lysate using anti-RAD50 antibody.Image submitted by a verified customer review.
(1 Review)
(78 Publications)
Species: Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, In vitro, KD, WB
NMDAR2B Antibody
NB300-106
Western Blot: NMDAR2B Antibody [NB300-106] - The blots show the examples of immunobands against NMDAR2B (C) and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (http://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY licence.
Flow Cytometry: NMDAR2B Antibody [NB300-106] - NMDA2B receptor expression on CD4+ T cells. Image supplied by review from confirmed customer.
Western Blot: NMDAR2B Antibody [NB300-106]
(3 Reviews)
(16 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
PSD Antibody
H00005662-B01P
Western Blot: PSD Antibody [H00005662-B01P] - Western Blot analysis of PSD expression in transfected 293T cell line (H00005662-T01) by PSD MaxPab polyclonal antibody. Lane1:PSD transfected lysate(112.64 KDa). Lane2:Non-transfected lysate.
Immunocytochemistry/Immunofluorescence: PSD Antibody [H00005662-B01P] - Analysis of purified antibody to PSD on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PSD Antibody [H00005662-B01P] - Analysis of PSD expression in transfected 293T cell line by PSD polyclonal antibody. Lane1:PSD transfected lysate(112.64 KDa). Lane2:Non-transfected lysate.
Species: Hu, Rt
Applications: ICC/IF, WB
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - This antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Tissue section of mouse pancreas using this antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in majority of the cells from acini, ducts and Islets of Langerhans in the section.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
PISD Antibody
(OTI4G5)
NBP2-46421
Immunohistochemistry: PISD Antibody (4G5) [NBP2-46421] - Analysis of Human colon tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: PISD Antibody (4G5) [NBP2-46421] - Analysis of Human lung tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Western Blot: PISD Antibody (4G5) [NBP2-46421] - Analysis of HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY PISD .
Species: Hu, Mu, Rt
Applications: IHC, WB
NMDAR1 Antibody
(R1JHL)
NB300-118
Western Blot: NMDAR1 Antibody (R1JHL) [NB300-118] - The blots show the examples of immunobands against NMDAR1 and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (http://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: NMDAR1 Antibody (R1JHL) [NB300-118] - Mouse neuron stained with anti-NMDAR1 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: NMDAR1 Antibody (R1JHL) [NB300-118] - Mixed rat cortical cultures (21 DIV) were labelled with anti-NMDAR1 (1:200) and anti-mouse CF568 (1:250). The antibody labels small punctae along the neuronal processes. No distinct features such as spines are visible. This image was submitted via customer Review.
(14 Reviews)
(17 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
MPP2 Antibody
NBP3-17060
Immunohistochemistry-Paraffin: MPP2 Antibody [NBP3-17060] - Staining of human epididymis shows high expression.
Immunohistochemistry-Paraffin: MPP2 Antibody [NBP3-17060] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: MPP2 Antibody [NBP3-17060] - Analysis in human epididymis and liver tissues using Anti-MPP2 antibody. Corresponding MPP2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
ATM Antibody
NB100-104
Flow Cytometry: ATM Antibody [NB100-104] - Analysis of PE conjugate of ATM Antibody [NB100-104PE]. An intracellular stain was performed on HeLa cells with ATM antibody [NB100-104PE] (blue) and a matched isotype control [NBP2-24893PE] (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone with ATM Antibody [NB100-104].
Flow Cytometry: ATM Antibody [NB100-104] - An intracellular stain was performed on HepG2 cells with PE-conjugated ATM antibody [NB100-104PE] (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin.
(2 Reviews)
(96 Publications)
Species: Ca, Hu, Ma, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, WB
NDOR1 Antibody
NBP1-88790
Immunocytochemistry/Immunofluorescence: NDOR1 Antibody [NBP1-88790] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human tonsil shows moderate cytoplasmic positivity in germinal center cells.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human testis shows moderate cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NMDAR2A Antibody
NB300-105
Western Blot: NMDAR2A Antibody [NB300-105] - GluN2B to GluN2A NMDAR switch and Ppt1-/--induced synaptic deficits are recapitulated in primary cortical neurons. (B) Representative immunoblot (top) and quantification of GluN2A levels (bottom) in WT and Ppt1-/- neurons at DIV7, 10, and 18. (D) Representative immunoblot (top) and quantification of the GluN2A/2B ratio (bottom) in WT and Ppt1-/- neurons at DIV7, 10, and 18. For all experiments in Figure 5, Ppt1-/- and WT were compared (n = 2 independent experiments with two repetitions/group) at each time point using t-test and the significance indicated as follows: *p<0.05 where indicated. Error bars represent s.e.m. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40316) licensed under a CC-BY licence.
Western Blot: NMDAR2A Antibody [NB300-105] - Hyperpalmitoylation of Fyn kinase and GluN2B is reversed in Ppt1-/- primary cortical neurons by palmitoylation inhibitor treatment. Representative post-APEGS immunoblot of GluN2A (NMDAR2A) with beta-actin loading control. Image collected and cropped by CiteAb from the following publication (https://elifesciences.org/articles/40316), licensed under a CC-BY licence.
Immunohistochemistry: NMDAR2A Antibody [NB300-105] - Immunostaining of rabbit retina showing NR2A in the rod and cone photoreceptors in the outer plexiform layer as well as the entire inner plexiform layer.
(15 Publications)
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, WB
SAE2 Antibody
(OTI4A3)
NBP2-03688
Western Blot: SAE2 Antibody (4A3) [NBP2-03688] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SAE2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SAE2.
Immunohistochemistry-Paraffin: SAE2 Antibody (4A3) [NBP2-03688] - Staining of paraffin-embedded Carcinoma of Human prostate tissue using anti-SAE2 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: SAE2 Antibody (4A3) [NBP2-03688] - Staining of paraffin-embedded Human endometrium tissue using anti-SAE2 mouse monoclonal antibody.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
ARX Antibody
AF7068
Western blot shows lysates of U‑87 MG human glioblastoma/astrocytoma cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, and human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for ARX at approximately 58 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ARX was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
ARX was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei of pancreatic islets. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(2 Publications)
Species: Hu
Applications: ICC, IHC, WB
SAP102 Antibody
NBP1-87691
SAP102 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SAP102 Antibody (NBP1-87691)(1)


Reviews for SAP102 Antibody (NBP1-87691) (0)

There are no reviews for SAP102 Antibody (NBP1-87691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAP102 Antibody (NBP1-87691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SAP102 Products

Bioinformatics Tool for SAP102 Antibody (NBP1-87691)

Discover related pathways, diseases and genes to SAP102 Antibody (NBP1-87691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP102 Antibody (NBP1-87691)

Discover more about diseases related to SAP102 Antibody (NBP1-87691).
 

Pathways for SAP102 Antibody (NBP1-87691)

View related products by pathway.

PTMs for SAP102 Antibody (NBP1-87691)

Learn more about PTMs related to SAP102 Antibody (NBP1-87691).
 

Research Areas for SAP102 Antibody (NBP1-87691)

Find related products by research area.

Blogs on SAP102

There are no specific blogs for SAP102, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP102 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DLG3