SAP102 Antibody

Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.

Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human colon shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human tonsil shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SAP102 Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: DLG3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SAP102 Protein (NBP1-87691PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19167192)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SAP102 Antibody

• discs, large homolog 3 (Drosophila)
• KIAA1232discs, large homolog 3 (neuroendocrine-dlg, Drosophila)
• MRX90MRX
• NEDLGdisks large homolog 3
• neuroendocrine-DLG
• SAP-102
• SAP102NE-Dlg
• Synapse-associated protein 102
• XLMR

Background

Synapse-Associated Protein 102 (SAP102) is one of a family of plasma membrane-associated proteins found in synaptic junctions. Like other members of the family, SAP102 has three ~90 amino acid repeats called PDZ domains followed by an SH3 domain and a yeast guanylate kinase homology (GuK) domain. It is hypothesized that PDZ-domain interactions play a role in receptor and channel clustering which contributes to neuronal plasticity. SAP102 is believed to participate in the clustering of certain proteins, including NMDA receptors, shaker-type potassium channels at the synaptic membrane in CNS neurons. NMDA receptors and Shaker-type potassium channels both share C-terminal sequence homology consisting of a threonine/serine-X-valine-COOH (T/SXV) motif. Other neuronal proteins that share this motif (beta 1 adrenergic receptor, some serotonin receptors, some sodium channel subunits, and additional potassium channel subunits) may interact with SAP102 by binding to its PDZ domains. Neuronal nitric oxide synthase (nNOS), which lacks the T/SXV motif but which has its own PDZ domain, has been shown to associate with SAP102 in vitro through a pseudo-homotypic PDZ-PDZ interaction.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SAP102 Antibody (NBP1-87691)(1)

Publication using NBP1-87691

• Qu M, Aronica E, Boer K et al. DLG3/SAP102 protein expression in malformations of cortical development: a study of human epileptic cortex by tissue microarray. Epilepsy Res 2009-03-01 [PMID: 19167192]

Bioinformatics

• Gene Symbol: DLG3