Home » SAP102 » SAP102 Antibodies » SAP102 Antibody

SAP102 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebral cortex shows distinct nuclear and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

SAP102 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Specificity
Specificity of human SAP102 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SAP102 Protein (NBP1-87691PEP)
Publications
Read Publication using NBP1-87691.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19167192)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAP102 Antibody

  • discs, large homolog 3 (Drosophila)
  • KIAA1232discs, large homolog 3 (neuroendocrine-dlg, Drosophila)
  • MRX90MRX
  • NEDLGdisks large homolog 3
  • neuroendocrine-DLG
  • SAP-102
  • SAP102NE-Dlg
  • Synapse-associated protein 102
  • XLMR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DLG1 Antibody
NB600-1229
Western Blot: DLG1 Antibody [NB600-1229] - Analysis of 25 ug of C6 (lane 1), PC12 (lane 2) and rat brain (lane 3) cell lysates.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of HeLa cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
Immunocytochemistry/Immunofluorescence: DLG1 Antibody [NB600-1229] - Analysis of SAP97 (green) showing staining in the cytoplasm and membrane of NIH-3T3 cells. Formalin-fixed cells were permeabilized with 0.1% Triton X-100 in TBS for 5-10 minutes and blocked with 3% BSA-PBS for 30 minutes at room temperature. Cells were probed with a SAP97 polyclonal antibody in 3% BSA-PBS at a dilution of 1:100 and incubated overnight at 4C in a humidified chamber. Cells were washed with PBST and incubated with a DyLight-conjugated secondary antibody in PBS at room temperature in the dark. F-actin (red) was stained with a fluorescent red phalloidin and nuclei (blue) were stained with Hoechst or DAPI.
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
PSD-95 Antibody
(6G6-1C9)
NB300-556
Western Blot: PSD-95 Antibody (6G6-1C9) [NB300-556] - Analysis of 25 ug of mouse brain (lane 1) and rat brain (lane 2) cell lysates.
Immunocytochemistry: PSD-95 Antibody (6G6-1C9) [NB300-556] - Mixed 3 week old rat cortical cultures (21 DIV) were labelled with anti-PSD95 (1:650) and visualised with anti-mouse Alexa647 (1:2000). The antibody labels small punctae along neuronal processes as expected. This image was submitted via customer Review.
Flow Cytometry: PSD-95 Antibody (6G6-1C9) [NB300-556] - An intracellular stain was performed on HeLa cells with PSD-95 Antibody (6G6-1C9) NB300-556AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
(1 Review)
(14 Publications)
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, ICC
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PSD93 Antibody
NBP1-88088
Immunocytochemistry/Immunofluorescence: PSD93 Antibody [NBP1-88088] - Staining of human cell line A-431 shows positivity in nucleus, nucleoli and vesicles.
Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: PSD93 Antibody [NBP1-88088] - Staining of human cerebellum shows strong cytoplasmic positivity in purkinje cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Rad50 Antibody
(13B3)
NB100-147
Western Blot: Rad50 Antibody (13B3) [NB100-147] - Non-transfected (-) and transfected (+) HeLa whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with Rad50 antibody [13B3].
Immunocytochemistry/Immunofluorescence: Rad50 Antibody (13B3) [NB100-147] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Rad50 protein stained by Rad50 antibody [13B3] diluted at 1:200. Red: phalloidin, a cytoskeleton marker, diluted at 1:200. Scale bar = 10um.
Immunohistochemistry-Paraffin: Rad50 Antibody (13B3) [NB100-147] - Paraffin-embedded human lung. Rad50 antibody [13B3] diluted at 1:200.
(1 Review)
(75 Publications)
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P, IP
NMDAR2B Antibody
NB300-106
Western Blot: NMDAR2B Antibody [NB300-106]
Flow Cytometry: NMDAR2B Antibody [NB300-106] - NMDA2B receptor expression on CD4+ T cells. Image supplied by review from confirmed customer.
(3 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
PSD Antibody
H00005662-B01P
Western Blot: PSD Antibody [H00005662-B01P] - Analysis of PSD expression in rat brain.
Immunocytochemistry/Immunofluorescence: PSD Antibody [H00005662-B01P] - Analysis of purified antibody to PSD on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: PSD Antibody [H00005662-B01P] - Western Blot analysis of PSD expression in transfected 293T cell line (H00005662-T01) by PSD MaxPab polyclonal antibody. Lane1:PSD transfected lysate(112.64 KDa). Lane2:Non-transfected lysate.
Species: Hu, Rt
Applications: WB, ICC/IF
MeCP2 Antibody
NB100-56326
Western Blot: MeCP2 Antibody [NB100-56326] - Analysis of MeCP2 in HeLa cell lysate using this antibody.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB100-56326] - MeCP2 antibody was tested in A431 cells at a 1:200 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 568 (Red) and DAPI (Blue), respectively.
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB100-56326] - Mouse liver tissue using MeCP2 antibody at 1:500 dilution. The antibody generated a very strong/specific nuclear staining with weak to negligible cytoplasmic signal in the hepatocytes, kupffer cells, and in the endothelial cells of blood vessels.
(1 Publication)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
PISD Antibody
NBP1-84212
Western Blot: PISD Antibody [NBP1-84212] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue. Lane 6: Human tonsil tissue
Immunocytochemistry/Immunofluorescence: PISD Antibody [NBP1-84212] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: PISD Antibody [NBP1-84212] - Staining of human placenta shows cytoplasmic positivity in trophoblasts.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NMDAR1 Antibody
(R1JHL)
NB300-118
Western Blot: NMDAR1 Antibody (R1JHL) [NB300-118]
Immunocytochemistry: NMDAR1 Antibody (R1JHL) [NB300-118] - NR1 surface staining of mouse corical neruons. This image was submitted via customer Review.
Immunocytochemistry: NMDAR1 Antibody (R1JHL) [NB300-118] - Mixed rat cortical cultures (21 DIV) were labelled with anti-NMDAR1 (1:200) and anti-mouse CF568 (1:250). The antibody labels small punctae along the neuronal processes. No distinct features such as spines are visible. This image was submitted via customer Review.
(14 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC-Fr, IHC-P, IP, ICC, IF
MPP2 Antibody
NBP1-85038
Western Blot: MPP2 Antibody [NBP1-85038] - Analysis in control (vector only transfected HEK293T lysate) and MPP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: MPP2 Antibody [NBP1-85038] - Immunofluorescent staining of human cell line A-431 shows localization to mitochondria.
Immunohistochemistry-Paraffin: MPP2 Antibody [NBP1-85038] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ATM Antibody
NB100-104
Western Blot: ATM Antibody [NB100-104] - Detection of ATM in HeLa nuclear extract using NB100-104. (30 sec. exposure)
Immunocytochemistry/Immunofluorescence: ATM Antibody [NB100-104] - HeLa cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X TBS + 0.05% Triton-X100. Then cells were incubated with anti-ATM (NB100-104) at a 1:100 dilution overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Alpha tubulin was used as a co-stain at a 1:1000 dilution and detected with an anti-mouse Dylight 550 (Red) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Immunohistochemistry-Paraffin: ATM Antibody [NB100-104] - Staining of human tonsil, germinal center and mantle zone.
(2 Reviews)
(84 Publications)
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NDOR1 Antibody
NBP1-88790
Western Blot: NDOR1 Antibody [NBP1-88790] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: NDOR1 Antibody [NBP1-88790] - Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol & intermediate filaments.
Immunohistochemistry-Paraffin: NDOR1 Antibody [NBP1-88790] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NMDAR2A Antibody
NBP2-19551
Western Blot: NMDAR2A Antibody [NBP2-19551] - Rat tissue extract (50 ug) was separated by 5% SDS-PAGE, and the membrane was blotted with NMDAR2A antibody diluted at 1:1000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody, and the signal was developed with Trident ECL plus-Enhanced.
Immunocytochemistry/Immunofluorescence: NMDAR2A Antibody [NBP2-19551] - DIV14 rat E18 primary cortical neurons were fixed in 4% paraformaldehyde at RT for 15 min. Green: NMDAR2A protein stained by NMDAR2A antibody diluted at 1:500.Red: beta Tubulin 3/ Tuj1, stained by beta Tubulin 3/ Tuj1 antibody [1338] diluted at 1:500. Blue: Fluoroshield with DAPI.
Immunohistochemistry-Paraffin: NMDAR2A Antibody [NBP2-19551] - NMDAR2A antibody detects GRIN2A protein at membrane on U87 xenograft by immunohistochemical analysis. Sample: Paraffin-embedded U87 xenograft. NMDAR2A antibody dilution: 1:500.
(1 Review)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
SAE2 Antibody
NB120-22104
Western Blot: SAE2 Antibody [NB120-22104] - Western bot analysis of SAE2 in HeLa cell lysate using NB120-22104 at 1.0 ug/ml.
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB
ARX Antibody
AF7068
Western blot shows lysates of U‑87 MG human glioblastoma/astrocytoma cell line, U‑118‑MG human glioblastoma/astrocytoma cell line, and human brain (cortex) tissue. PVDF membrane was probed with 2 µg/mL of Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for ARX at approximately 58 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ARX was detected in immersion fixed U‑87 MG human glioblastoma/astrocytoma cell line using Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red, upper panel; Catalog # NL010) and counterstained with DAPI (blue, lower panel). Specific staining was localized to nuclei. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
ARX was detected in immersion fixed paraffin-embedded sections of human pancreas using Sheep Anti-Human ARX Antigen Affinity-purified Polyclonal Antibody (Catalog # AF7068) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to nuclei of pancreatic islets. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC, ICC
SAP102 Antibody
NBP1-87691
SAP102 Antibody
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SAP102 Antibody (NBP1-87691)(1)


Reviews for SAP102 Antibody (NBP1-87691) (0)

There are no reviews for SAP102 Antibody (NBP1-87691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAP102 Antibody (NBP1-87691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for SAP102 Antibody (NBP1-87691)

Discover related pathways, diseases and genes to SAP102 Antibody (NBP1-87691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP102 Antibody (NBP1-87691)

Discover more about diseases related to SAP102 Antibody (NBP1-87691).
 

Pathways for SAP102 Antibody (NBP1-87691)

View related products by pathway.

PTMs for SAP102 Antibody (NBP1-87691)

Learn more about PTMs related to SAP102 Antibody (NBP1-87691).
 

Research Areas for SAP102 Antibody (NBP1-87691)

Find related products by research area.

Blogs on SAP102

There are no specific blogs for SAP102, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP102 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol DLG3