SAP102 Antibody

Images

 
Western Blot: SAP102 Antibody [NBP1-87691] - Analysis in control (vector only transfected HEK293T lysate) and DLG3 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human cerebellum shows strong cytoplasmic positivity in cells in molecular layer.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human colon shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human tonsil shows no positivity in glandular cells as expected.
Immunohistochemistry-Paraffin: SAP102 Antibody [NBP1-87691] - Staining of human hippocampus shows strong cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SAP102 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: HKHQHCCKCPECYEVTRLAALRRLEPPGYGDWQVPDPYGPGGGNGASAGYGGYSSQTLPSQAGATPTPRTKAKLIPTGRDVGPVPPKPVPGKSTPKLNGSGPSWWPECTCTNRDWYEQVNGSD
Specificity
Specificity of human SAP102 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DLG3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Publications
Read Publication using NBP1-87691.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 19167192)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SAP102 Antibody

  • discs, large homolog 3 (Drosophila)
  • KIAA1232discs, large homolog 3 (neuroendocrine-dlg, Drosophila)
  • MRX90MRX
  • NEDLGdisks large homolog 3
  • neuroendocrine-DLG
  • SAP-102
  • SAP102NE-Dlg
  • Synapse-associated protein 102
  • XLMR

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1229
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-12912
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NB100-147
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP, In vitro, KD
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
H00005662-B01P
Species: Hu, Rt
Applications: WB, ICC/IF
NB600-1101
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-46421
Species: Hu
Applications: WB, IHC
NB300-118
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu, Rt, Ca, Ma
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-45856
Species: Hu, Mu, Ca
Applications: WB, IHC, IF
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
NB120-22104
Species: Hu, Mu, Rt
Applications: WB
AF7068
Species: Hu
Applications: WB, IHC, ICC
NBP1-87691
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for SAP102 Antibody (NBP1-87691)(1)

Reviews for SAP102 Antibody (NBP1-87691) (0)

There are no reviews for SAP102 Antibody (NBP1-87691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAP102 Antibody (NBP1-87691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SAP102 Products

Bioinformatics Tool for SAP102 Antibody (NBP1-87691)

Discover related pathways, diseases and genes to SAP102 Antibody (NBP1-87691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SAP102 Antibody (NBP1-87691)

Discover more about diseases related to SAP102 Antibody (NBP1-87691).
 

Pathways for SAP102 Antibody (NBP1-87691)

View related products by pathway.

PTMs for SAP102 Antibody (NBP1-87691)

Learn more about PTMs related to SAP102 Antibody (NBP1-87691).
 

Research Areas for SAP102 Antibody (NBP1-87691)

Find related products by research area.

Blogs on SAP102

There are no specific blogs for SAP102, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SAP102 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DLG3
COVID-19 update