CAPZB Antibody

Images

 
Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.
Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.
Western Blot: CAPZB Antibody [NBP1-85922] - Analysis in human cell line A-431.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CAPZB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CAPZB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CAPZB Protein (NBP1-85922PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CAPZB Antibody

  • Cap Z
  • CAPB
  • CAPPB
  • capping protein (actin filament) muscle Z-line, beta
  • CapZ beta
  • CAPZ
  • F-actin capping protein beta subunit
  • F-actin-capping protein subunit beta
  • MGC104401
  • MGC129749
  • MGC129750

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33177
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29403
Species: Hu, Mu, Rt, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-86635
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00527
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02500
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-80745
Species: Hu
Applications: WB, IHC, IHC-P
H00051380-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF1444
Species: Mu
Applications: WB, IHC
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01017
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB600-1206
Species: Hu, Mu, Rt, Av, Ch, Fi, Ma, Re
Applications: WB, EM, ICC/IF, IHC, IHC-Fr
NBP1-30955
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-00955
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for CAPZB Antibody (NBP1-85922) (0)

There are no publications for CAPZB Antibody (NBP1-85922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAPZB Antibody (NBP1-85922) (0)

There are no reviews for CAPZB Antibody (NBP1-85922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CAPZB Antibody (NBP1-85922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CAPZB Products

Bioinformatics Tool for CAPZB Antibody (NBP1-85922)

Discover related pathways, diseases and genes to CAPZB Antibody (NBP1-85922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CAPZB Antibody (NBP1-85922)

Discover more about diseases related to CAPZB Antibody (NBP1-85922).
 

Pathways for CAPZB Antibody (NBP1-85922)

View related products by pathway.

PTMs for CAPZB Antibody (NBP1-85922)

Learn more about PTMs related to CAPZB Antibody (NBP1-85922).

Blogs on CAPZB

There are no specific blogs for CAPZB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CAPZB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CAPZB