CAPZB Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: CAPZB Antibody [NBP1-85922] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.

Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Testis shows strong cytoplasmic and membranous positivity in cells in seminiferous ducts and Leydig cells.

Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Skeletal muscle shows very weak cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: CAPZB Antibody [NBP1-85922] - Staining of human Tonsil shows strong cytoplasmic and membranous positivity in germinal center and non-germinal center cells.

Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line A-431.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAPZB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CAPZB Antibody - BSA Free (NBP1-85922) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPZB
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  CAPZB Protein (NBP1-85922PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAPZB Antibody - BSA Free

• Cap Z
• CAPB
• CAPPB
• capping protein (actin filament) muscle Z-line, beta
• CapZ beta
• CAPZ
• F-actin capping protein beta subunit
• F-actin-capping protein subunit beta
• MGC104401
• MGC129749
• MGC129750

Background

CAPZB is involved in the regulation of growth of the actin filament by capping the barbed end of growing actin filaments

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPZB