![Western Blot: NCAPH Antibody [NBP1-88345] - Analysis using Anti-NCAPH antibody NBP1-88345 (A) shows similar pattern to independent antibody NBP1-88346 (B).](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Western-Blot-NBP1-88345-img0021.jpg "Western Blot: NCAPH Antibody [NBP1-88345] - Analysis using Anti-NCAPH antibody NBP1-88345 (A) shows similar pattern to independent antibody NBP1-88346 (B).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, IHC-P, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI |
| Localization | Subcellular |
| Specificity | Specificity of human NCAPH antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCAPH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 82 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for NCAPH Antibody (NBP1-88345)Discover more about diseases related to NCAPH Antibody (NBP1-88345).
| Pathways for NCAPH Antibody (NBP1-88345)View related products by pathway.
|
PTMs for NCAPH Antibody (NBP1-88345)Learn more about PTMs related to NCAPH Antibody (NBP1-88345).
| Research Areas for NCAPH Antibody (NBP1-88345)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NCAPH |
![Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88345-img0017.jpg "Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0020.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).")
![Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Western-Blot-NBP1-88345-img0018.jpg "Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
![Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Western-Blot-NBP1-88345-img0019.jpg "Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0012.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0013.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0014.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0015.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues. Corresponding NCAPH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0016.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues. Corresponding NCAPH RNA-seq data are presented for the same tissues.")
![Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Simple-Western-NBP1-88345-img0006.jpg "Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize2/NCAPH-Antibody-Simple-Western-NBP1-88345-img0007.jpg "Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Western Blot: SMC2 Antibody [NB100-373] - Detection of Human SMC2 by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa and 293T cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-SMC2 antibody NB100-373 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.](http://images.novusbio.com/fullsize2/SMC2-Antibody-Western-Blot-NB100-373-img0014.jpg)
![Western Blot: SMC2 Antibody [NB100-373] - Detection of Human SMC2 on HeLa whole cell lysate using NB100-373.](http://images.novusbio.com/fullsize2/SMC2-Antibody-Western-Blot-NB100-373-img0001.jpg)
![Western Blot: SMC2 Antibody [NB100-373] - Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibod ies : Affinity purified rabbit anti-SMC2 antibody (lot was used at 1 ug/ml. Detection: Chemiluminescence with an exposure time of 3 seconds.](http://images.novusbio.com/fullsize2/SMC2-Antibody-Western-Blot-NB100-373-img0012.jpg)
![Western Blot: CNAP1 Antibody (4C12) [H00009918-M01] - CNAP1 monoclonal antibody (M01), clone 4C12 Analysis of CNAP1 expression in HeLa.](http://images.novusbio.com/fullsize2/CNAP1-Antibody-(4C12)-Western-Blot-H00009918-M01-img0013.jpg)
![Immunocytochemistry/Immunofluorescence: CNAP1 Antibody (4C12) [H00009918-M01] - Analysis of monoclonal antibody to CNAP1 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize2/CNAP1-Antibody-(4C12)-Immunocytochemistry-Immunofluorescence-H00009918-M01-img0009.jpg)
![Immunohistochemistry-Paraffin: CNAP1 Antibody (4C12) [H00009918-M01] - Analysis of monoclonal antibody to CNAP1 on formalin-fixed paraffin-embedded human placenta. Antibody concentration 3 ug/ml.](http://images.novusbio.com/fullsize2/CNAP1-Antibody-(4C12)-Immunohistochemistry-Paraffin-H00009918-M01-img0011.jpg)
![Western Blot: SMC4 Antibody [NBP1-86635] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize2/SMC4-Antibody-Western-Blot-NBP1-86635-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: SMC4 Antibody [NBP1-86635] - Staining of human cell line U-2 OS shows localization to nuclear speckles & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/SMC4 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-86635-img0008.jpg)
![Immunohistochemistry-Paraffin: SMC4 Antibody [NBP1-86635] - Staining of human kidney shows strong cytoplasmic positivity with granular pattern in tubule cells.](http://images.novusbio.com/fullsize2/SMC4-Antibody-Immunohistochemistry-Paraffin-NBP1-86635-img0002.jpg)
![Western Blot: SMC3 Antibody [NB100-207] - Whole cell lysate (10 ug) from HEK293T, HeLa, Jurkat, LNCaP, U2OS, A-549, TCMK-1, and NIH 3T3 cells prepared using NETN lysis buffer. Antibody: Affinitypurified rabbit anti-SMC3 antibody used for WB at 0.04 ug/ml. Detection:Chemiluminescence with an exposure time of 3 seconds.](http://images.novusbio.com/fullsize2/SMC3-Antibody-Western-Blot-NB100-207-img0026.jpg)
![Immunohistochemistry-Paraffin: SMC3 Antibody [NB100-207] - Section of mouse renal cell carcinoma. Antibody: Affinity purified rabbit anti-SMC3 used at 1:5,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/SMC3-Antibody-Immunohistochemistry-Paraffin-NB100-207-img0028.jpg)
![Immunohistochemistry-Paraffin: SMC3 Antibody [NB100-207] - Section of human breast carcinoma. Antibody: Affinity purified rabbit anti-SMC3 used at 1:5,000 (0.2ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/SMC3-Antibody-Immunohistochemistry-Paraffin-NB100-207-img0027.jpg)
![Western Blot: RNGTT Antibody [NBP1-49973] - Detection of Human and Mouse RNGTT by Western Blot (h&m) and Immunoprecipitation (h). Samples: Whole cell lysate from HeLa (5, 15 and 50 mcg for WB; 1 mg for IP, 20% of IP loaded), 293T (T; 50 mcg), and mouse NIH3T3 (M; 50 mcg) cells. Antibodies: Affinity purified rabbit anti-RNGTT antibody used for WB at 0.04 mcg/ml (A) and 0.4 mcg/ml (B) and used for IP at 3 mcg/mg lysate. RNGTT was also immunoprecipitated by rabbit anti-RNGTT antibody which recognizes an upstream epitope. For blotting immunoprecipitated RNGTT was used. Detection: Chemiluminescence with exposure times of 3 minutes (A) and 30 seconds (B).](http://images.novusbio.com/fullsize2/RNGTT-Antibody-Western-Blot-NBP1-49973-img0001.jpg)
![Immunohistochemistry-Paraffin: RNGTT Antibody [NBP1-49973] - Section of human ovarian carcinoma. Antibody: Affinity purified rabbit anti- RNGTT used at a dilution of 1:200 (1ug/ml). Detection: Vector Laboratories ImmPACT NovaRED Peroxidase Substrate.](http://images.novusbio.com/fullsize2/RNGTT-Antibody-Immunohistochemistry-NBP1-49973-img0003.jpg)
![Western Blot: NCAPD3 Antibody [NB100-1573] - Detection of human CAP-D3 by western blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-CAP-D3 antibody NB100-1573 (lotNB100-1573-4) used for WB at 0.04 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/NCAPD3-Antibody-NB100-1573-img0001.jpg)
![Immunoprecipitation: NCAPD3 Antibody [NB100-1573] - Detection of human CAP-D3 by western blot of immunoprecipitates. Samples: Whole cell lysate (1.0 mg per IP reaction; 20% of IP loaded) from 293T cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-CAP-D3 antibody (lot NB100-1573-4) used for IP at 6 ug per reaction. CAP-D3 was also immunoprecipitated by a previous lot of this antibody (lot NB100-1573-3). For blotting immunoprecipitated CAP-D3, NB100-1573 was used at 0.2 ug/ml. Detection: Chemiluminescence with an exposure time of 1 second.](http://images.novusbio.com/fullsize2/NCAPD3-Antibody-NB100-1573-img0002.jpg)
![SDS-Page: Recombinant Human CEP250 Protein [H00011190-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00011190-Q01-1.jpg)
![Western Blot: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Whole cell protein from human HeLa, A431, mouse Neuro2A and rat PC12 cells was separated on a 4-20% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Histone h3 in block buffer and detected with an anti-mouse HRP secondary antibody using chemiluminescence. Observed molecular weight is ~15 kDa.](http://images.novusbio.com/fullsize2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Western-Blot-NBP1-30141-img0012.jpg)
![Immunohistochemistry-Paraffin: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Histone 3 was detected in immersion fixed paraffin-embedded sections of human colon cancer using anti-human mouse monoclonal antibody (Catalog # NBP1-30141) at 1:1000 dilution overnight at 4C. Tissue was stained using the VisuCyte anti-mouse HRP polymer detection reagent (Catalog # VC001) with DAB chromogen (brown) and counterstained with hematoxylin (blue). Images may not be copied, printed or otherwise disseminated without express written permission of Novus Biologicals a bio-techne brand.](http://images.novusbio.com/fullsize2/Histone-H3-[Trimethyl-Lys9]-Antibody-(6F12-H4)-Immunohistochemistry-Paraffin-NBP1-30141-img0010.jpg)
![Chromatin Immunoprecipitation: Histone H3 [Trimethyl Lys9] Antibody (6F12-H4) [NBP1-30141] - Used to perform ChIP on HeLa cells.](http://images.novusbio.com/fullsize2/Histone H3 [Trimethyl Lys9] Antibody (6F12-H4)-Chromatin Immunoprecipitation-NBP1-30141-img0002.jpg)
![Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Image of anti-Caspase 3 (31A1067). Whole cell protein from Jurkat cells treated with and without 2 uM staurosporine as indicated was separated on a 4-15% gel by SDS-PAGE, transferred to 0.2 um PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 5 ug/ml anti-Caspase 3 in 1% milk, and detected with an anti-mouse HRP secondary antibody using a Femto sensitivity chemiluminescence reagent. Note the detection of both pro-caspase 3 at 35 kDa and the cleaved active caspase 3 at 15-17 kDa.](http://images.novusbio.com/fullsize2/Caspase-3-Antibody-(31A1067)---(Pro-and-Active)-Western-Blot-NB100-56708-img0031.jpg)
![Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Paclitaxel in combination with MWE retarded tumor growth in a human bladder carcinoma TSGH 8301 xenograft model. The levels of total (t-PTEN) and phospho-PTEN (p-PTEN) and Caspase 3 in the tumor specimens were determined by Western blotting and then quantified using beta-actin as the protein loading control; the results are expressed as a percentage of the control. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep20417), licensed under a CC-BY licence.](http://images.novusbio.com/fullsize2/Caspase-3 Antibody (31A1067) - (Pro and Active)-Western Blot-NB100-56708-img0044.jpg)
![Immunohistochemistry-Paraffin: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Tissue section of human spleen using 1:200 dilution of Caspase-3 antibody (clone 31A1067). The staining was developed with HRP labeled anti-mouse IgG secondary antibody and DAB reagent, and nuclei of cells were counter-stained with hematoxylin. This Caspase 3 antibody generated primarily a specific cytoplasmic staining in a subset of spleenocytes with some nuclear signal in a few cells.](http://images.novusbio.com/fullsize2/Caspase-3-Antibody-(31A1067)---(Pro-and-Active)-Immunohistochemistry-Paraffin-NB100-56708-img0042.jpg)
![Western Blot: BRD4 Antibody (BL-149-2H5) [NBP2-76393] - Detection of mouse BRD4 by WB of BW5147.3 lysate. Antibody: BRD4 Antibody (BL-149-2H5). Secondary: HRP-conjugated goat anti-rabbit IgG.](http://images.novusbio.com/fullsize2/BRD4-Antibody-(BL-149-2H5)-Western-Blot-NBP2-76393-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: BRD4 Antibody (BL-149-2H5) [NBP2-76393] - Antibody: Rabbit anti-BRD4 recombinant monoclonal [BL-149-2H5] (NBP2-76393). Secondary: DyLight 550-conjugated goat anti-rabbit IgG. Counterstain: Phalloidin Alexa Fluor 488-conjugated (green).](http://images.novusbio.com/fullsize2/BRD4-Antibody-(BL-149-2H5)-Immunocytochemistry-Immunofluorescence-NBP2-76393-img0002.jpg)
![Immunohistochemistry-Paraffin: BRD4 Antibody (BL-149-2H5) [NBP2-76393] - Detection of human BRD4 in FFPE Hela cells by ICC. Antibody: BRD4 Antibody (BL-149-2H5). Secondary: HRP-conjugated goat anti-rabbit IgG. Substrate: DAB.](http://images.novusbio.com/fullsize2/BRD4-Antibody-(BL-149-2H5)-Immunohistochemistry-Paraffin-NBP2-76393-img0009.jpg)
![Western Blot: CDC2/CDK1 Antibody [NBP1-85729] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/CDC2-CDK1-Antibody-Western-Blot-NBP1-85729-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: CDC2/CDK1 Antibody [NBP1-85729] - Staining of human cell line U-251 MG shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/CDC2-CDK1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85729-img0010.jpg)
![Immunohistochemistry-Paraffin: CDC2/CDK1 Antibody [NBP1-85729] - Staining in human tonsil and pancreas tissues. Corresponding CDK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/CDC2-CDK1 Antibody-Immunohistochemistry-Paraffin-NBP1-85729-img0015.jpg)
![Western Blot: VAChT/SLC18A3 Antibody [NB100-91348] - Rat and mouse tissue lysates. Blocking: 1% LFDM for 30 min at RT; primary antibody: dilution 1:2000 incubated at 4C overnight.](http://images.novusbio.com/fullsize2/VAChT-SLC18A3-Antibody-Western-Blot-NB100-91348-img0032.jpg)
![Immunohistochemistry-Paraffin: VAChT/SLC18A3 Antibody [NB100-91348] - Rat spinal cord. The animal was perfused using Autoperfuser at a pressure of 130 mmHg with 300 ml 4% FA before being processed for paraffin embedding. HIER: Tris-EDTA, pH 9 for 20 min using Thermo PT Module. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um.](http://images.novusbio.com/fullsize2/VAChT-SLC18A3-Antibody-Immunohistochemistry-Paraffin-NB100-91348-img0031.jpg)
![Immunohistochemistry-Paraffin: VAChT/SLC18A3 Antibody [NB100-91348] - IHC on rat spinal cord (paraffin section) using Rabbit antibody to (Vesicular Acetylcholine Transporter) VACHT: whole serum at 1 : 200 dilution incubated overnight at 4C, developed with DAB/Ni and counterstained with hematoxylin.](http://images.novusbio.com/fullsize2/VAChT-SLC18A3-Antibody-Immunohistochemistry-Paraffin-NB100-91348-img0015.jpg)
![Western Blot: ATRX Antibody [NBP1-83077] - Analysis in A-549 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using anti-ATRX antibody. Remaining relative intensity is presented. Loading control: anti-GAPDH.](http://images.novusbio.com/fullsize2/ATRX-Antibody-Western-Blot-NBP1-83077-img0028.jpg)
![Immunocytochemistry/Immunofluorescence: ATRX Antibody [NBP1-83077] - Staining of human cell line A549 shows localization to nucleoplasm and nuclear bodies. Antibody staining is shown in green.](http://images.novusbio.com/fullsize2/ATRX-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83077-img0029.jpg)
![Immunohistochemistry-Paraffin: ATRX Antibody [NBP1-83077] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/ATRX-Antibody-Immunohistochemistry-Paraffin-NBP1-83077-img0027.jpg)
![Western Blot: Nav1.7 Antibody (S68-6) [NBP2-12904] - analysis of hamster CHO cells showing detection of Nav1.7 Sodium Channel protein using Mouse Anti-Nav1.7 Sodium Channel Monoclonal Antibody, Clone S68-6. Load: 15 ug protein. Block: 1.5% BSA for 30 minutes at RT. Primary Antibody: Mouse Anti-Nav1.7 Sodium Channel Monoclonal Antibody at 1:1000 for 2 hours at RT. Secondary Antibody: Sheep Anti-Mouse IgG: HRP for 1 hour at RT.](http://images.novusbio.com/fullsize2/Nav1.7-Antibody-(S68-6)-Western-Blot-NBP2-12904-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: Nav1.7 Antibody (S68-6) [NBP2-12904] - Human hippocampal sections using this antibody.](http://images.novusbio.com/fullsize2/Nav1.7-Antibody-(S68-6)-Immunocytochemistry-NBP2-12904-img0007.jpg)
![Immunohistochemistry-Paraffin: Nav1.7 Antibody (S68-6) [NBP2-12904] - Tissue: backskin. Species: Mouse. Fixation: Bouins Fixative and paraffin-embedded. Primary Antibody: Mouse Anti-Nav1.7 Sodium Channel Monoclonal Antibody at 1:100 for 1 hour at RT. Secondary Antibody: FITC Goat Anti-Mouse (green) at 1:50 for 1 hour at RT.](http://images.novusbio.com/fullsize2/Nav1.7-Antibody-(S68-6)-Immunohistochemistry-Paraffin-NBP2-12904-img0012.jpg)
![Western Blot: ESCO2 Antibody [NB100-87021] - Detection of Human ESCO2 by Western Blot. Samples: Whole cell lysate (50, 15, 5 ug) from HeLa cells prepared using NETN lysis buffer. Antibody: Affinity purified rabbit anti-ESCO2 antibody NB100-87021 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/ESCO2-Antibody-Western-Blot-NB100-87021-img0007.jpg)
![Immunoprecipitation: ESCO2 Antibody [NB100-87021] - Detection of human ESCO2 by western blot of immunoprecipitates. Samples: Whole cell lysate (0.5 or 1.0 mg per IP reaction; 20% of IP loaded) from HeLa cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-ESCO2 antibody NB100-87021 (lot 2) used for IP at 6 ug per reaction. ESCO2 was also immunoprecipitated by a previous lot of this antibody (lot 1) and rabbit anti-ESCO2 antibody from Company B. For blotting immunoprecipitated ESCO2, NB100-87021 was used at 0.4 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/fullsize2/ESCO2-Antibody-Immunoprecipitation-NB100-87021-img0008.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0006.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - An intracellular stain was performed on Raji cells with Adiponectin antibody NB100-65810 (blue) and a matched isotype control NBP2-24893 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 1 ug/mL for 30 minutes at room temperature, followed by Dylight488-conjugated anti-rabbit secondary antibody. Image using the Azide Free form of this antibody.")