NCAPH Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues . Corresponding NCAPH RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.

Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.

Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).

Analysis in human cell lines U2OS and SK-MEL-30 using Anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.

• Reactivity: Hu
• Applications: WB, Simple Western, ICC/IF, IHC, Mycoplasma
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NCAPH Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NCAPH Antibody - BSA Free (NBP1-88345) is a polyclonal antibody validated for use in IHC, WB, ICC/IF and Simple Western. Anti-NCAPH Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI
• Localization: Subcellular
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NCAPH
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Knockdown Validated
  • Simple Western 1:20
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In
  
  In Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4 and U-251MG, separated by Size, antibody dilution of 1:20, apparent MW was 127 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Theoretical MW: 82 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  NCAPH Protein (NBP1-88345PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (81%), Rat (84%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for NCAPH Antibody - BSA Free

• barren (Drosophila) homolog
• barren homolog (Drosophila)
• barren homolog 1 (Drosophila)
• barren homolog 1
• Barren homolog protein 1
• BRRN
• BRRN1CAP-H
• CAPH
• Chromosome-associated protein H
• condensin complex subunit 2
• HCAP-H
• KIAA0074
• Non-SMC condensin I complex subunit H
• non-SMC condensin I complex, subunit H
• XCAP-H homolog

Background

NCAPH encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NCAPH Antibody (NBP1-88345)(4)

Publications using NBP1-88345

• Eykelenboom J, Gierliński M, Yue Z et al. Nuclear exclusion of condensin I in prophase coordinates mitotic chromosome reorganization to ensure complete sister chromatid resolution. Current biology : CB 2025-03-13 [PMID: 40107266]
• Peiluo Huang, Hongtao Zhao, Ruonan Sun, Chunyan Liu, Lei Wu, Yao Wang, Zhengwei Gan, Xiuzhen Yang, Juan Du MiR-1976/NCAPH/P65 axis inhibits the malignant phenotypes of lung adenocarcinoma Scientific Reports 2024-05-16 [PMID: 38755247]
• Chu L, Liang Z, Mukhina M et al. The 3D Topography of Mitotic Chromosomes Mol. Cell 2020-07-31 [PMID: 32768407]
• Davalos V, Suarez-Lopez L, Castano J et al. Human SMC2 Protein, a Core Subunit of Human Condensin Complex, Is a Novel Transcriptional Target of the WNT Signaling Pathway and a New Therapeutic Target. J Biol Chem 2012-12-21 [PMID: 23095742]

Bioinformatics

• Gene Symbol: NCAPH