Smad5 Antibody (5E12.)

Images

 
Western Blot: Smad5 Antibody (5E12) [H00004090-M08] - Analysis of SMAD5 expression in HeLa (Cat # L013V1).
ELISA: Smad5 Antibody (5E12) [H00004090-M08] - Detection limit for recombinant GST tagged SMAD5 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5E12.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smad5 Antibody (5E12.) Summary

Immunogen
SMAD5 (AAH09682, 105 a.a. - 182 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNN
Specificity
SMAD5 - SMAD, mothers against DPP homolog 5 (Drosophila) (5E12)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD5
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad5 Antibody (5E12.)

  • Dwfc
  • hSmad5
  • JV5-1
  • JV5-1DKFZp781O1323
  • MAD homolog 5
  • MAD, mothers against decapentaplegic homolog 5 (Drosophila)
  • MADH5
  • MADH5mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic homolog 5
  • mothers against decapentaplegic, drosophila, homolog of, 5
  • Mothers against DPP homolog 5
  • SMA- and MAD-related protein 5
  • SMAD 5
  • SMAD family member 5DKFZp781C1895
  • SMAD, mothers against DPP homolog 5 (Drosophila)
  • SMAD, mothers against DPP homolog 5
  • Smad5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45808
Species: Hu
Applications: IHC
NB100-56656
Species: Hu, Mu, Rt
Applications: WB
AF7215
Species: Hu, Mu
Applications: IHC, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
AF3025
Species: Hu
Applications: WB, ICC
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
AF4377
Species: Hu, Mu
Applications: WB, ICC
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
H00004090-M08
Species: Hu
Applications: WB, ELISA

Publications for Smad5 Antibody (H00004090-M08) (0)

There are no publications for Smad5 Antibody (H00004090-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad5 Antibody (H00004090-M08) (0)

There are no reviews for Smad5 Antibody (H00004090-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad5 Antibody (H00004090-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad5 Products

Bioinformatics Tool for Smad5 Antibody (H00004090-M08)

Discover related pathways, diseases and genes to Smad5 Antibody (H00004090-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad5 Antibody (H00004090-M08)

Discover more about diseases related to Smad5 Antibody (H00004090-M08).
 

Pathways for Smad5 Antibody (H00004090-M08)

View related products by pathway.

PTMs for Smad5 Antibody (H00004090-M08)

Learn more about PTMs related to Smad5 Antibody (H00004090-M08).
 

Research Areas for Smad5 Antibody (H00004090-M08)

Find related products by research area.

Blogs on Smad5

There are no specific blogs for Smad5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad5 Antibody (5E12.) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD5
Entrez
Uniprot