Smad1 Antibody (1B8)

Images

 
Western Blot: Smad1 Antibody (1B8) [H00004086-M06] - Analysis of SMAD1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: Smad1 Antibody (1B8) [H00004086-M06] - Analysis of SMAD1 expression in HeLa (Cat # L013V1).
Western Blot: Smad1 Antibody (1B8) [H00004086-M06] - Analysis of SMAD1 expression in PC-12 (Cat # L012V1).
Western Blot: Smad1 Antibody (1B8) [H00004086-M06] - Analysis of SMAD1 expression in NIH/3T3 (Cat # L018V1).

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Smad1 Antibody (1B8) Summary

Immunogen
SMAD1 (AAH01878.1, 1 a.a. - 465 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQPSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPNSHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQPMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
Specificity
SMAD1 - SMAD, mothers against DPP homolog 1 (Drosophila) (1B8)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SMAD1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Smad1 Antibody (1B8)

  • BSP1
  • BSP-1
  • hSMAD1
  • JV4-1SMAD, mothers against DPP homolog 1 (Drosophila)
  • MAD homolog 1
  • MADH1JV41
  • MADR1MAD, mothers against decapentaplegic homolog 1 (Drosophila)
  • Mad-related protein 1
  • mothers against decapentaplegic homolog 1
  • Mothers against DPP homolog 1
  • SMAD family member 1SMAD 1
  • SMAD, mothers against DPP homolog 1
  • Smad1
  • TGF-beta signaling protein 1
  • transforming growth factor-beta signaling protein 1

Background

The protein encoded by this gene belongs to the SMAD, a family of proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. SMAD proteins are signal transducers and transcriptional modulators that mediate multiple signaling pathways. This protein mediates the signals of the bone morphogenetic proteins (BMPs), which are involved in a range of biological activities including cell growth, apoptosis, morphogenesis, development and immune responses. In response to BMP ligands, this protein can be phosphorylated and activated by the BMP receptor kinase. The phosphorylated form of this protein forms a complex with SMAD4, which is important for its function in the transcription regulation. This protein is a target for SMAD-specific E3 ubiquitin ligases, such as SMURF1 and SMURF2, and undergoes ubiquitination and proteasome-mediated degradation. Alternatively spliced transcript variants encoding the same protein have been observed.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
AF2097
Species: Hu
Applications: WB, ChIP, ICC
AF2250
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF7215
Species: Hu, Mu
Applications: IHC, ICC
NB100-56440
Species: Hu, Mu, Rt, Pm, Sh
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF3025
Species: Hu
Applications: WB, ICC
AF770
Species: Mu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
MAB2029
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for Smad1 Antibody (H00004086-M06) (0)

There are no publications for Smad1 Antibody (H00004086-M06).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Smad1 Antibody (H00004086-M06) (0)

There are no reviews for Smad1 Antibody (H00004086-M06). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Smad1 Antibody (H00004086-M06) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Smad1 Products

Bioinformatics Tool for Smad1 Antibody (H00004086-M06)

Discover related pathways, diseases and genes to Smad1 Antibody (H00004086-M06). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Smad1 Antibody (H00004086-M06)

Discover more about diseases related to Smad1 Antibody (H00004086-M06).
 

Pathways for Smad1 Antibody (H00004086-M06)

View related products by pathway.

PTMs for Smad1 Antibody (H00004086-M06)

Learn more about PTMs related to Smad1 Antibody (H00004086-M06).
 

Research Areas for Smad1 Antibody (H00004086-M06)

Find related products by research area.

Blogs on Smad1.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Nanog is a Master Controller of ES cell Pluripotency
Nanog, a homeodomain (HD) transcription factor, plays a critical role in the maintenance of embryonic stem (ES) cell self-renewal. Transcription regulator involved in inner cell mass and ES cell proliferation and self-renewal. Imposes pluripotency on...  Read full blog post.

Transforming Growth Factor beta Signaling in Stem Cells
Transforming growth factor beta (TGF beta) signaling along with its family members have been implicated in development and maintenance of various organs. Stem cells are important contributors to this process and are characterized by their ability to s...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Smad1 Antibody (1B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol SMAD1
Entrez
Uniprot