PEPT1/SLC15A1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: PEPT1/SLC15A1 Antibody [NBP1-92005] - Staining of human cell line CACO-2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: PEPT1/SLC15A1 Antibody [NBP1-92005] - Staining of human small intestine shows strong membranous and moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

PEPT1/SLC15A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DKTLPVFPKGNEVQIKVLNIGNNTMNISLPGEMVTLGPMSQTNAFMTFDVNKLTRINISSPGSPVTAVTDDFKQGQRHTLLVWAPNHYQVVKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC15A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
PEPT1/SLC15A1 Protein (NBP1-92005PEP)
Publications
Read Publication using
NBP1-92005 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PEPT1/SLC15A1 Antibody

  • Caco-2 oligopeptide transporter
  • HPECT1macrophage oligopeptide transporter PEPT1
  • HPEPT1
  • Intestinal H(+)/peptide cotransporter
  • Oligopeptide transporter, small intestine isoform
  • PEPT1
  • PEPT1intestinal H+/peptide cotransporter
  • Peptide transporter 1
  • SLC15A1
  • solute carrier family 15 (oligopeptide transporter), member 1
  • solute carrier family 15 member 1

Background

Proton-coupled intake of oligopeptides of 2 to 4 amino acids with a preference for dipeptides. May constitute a major route for the absorption of protein digestion end-products

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for PEPT1/SLC15A1 Antibody (NBP1-92005)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.


Filter By Application
ICC/IF
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for PEPT1/SLC15A1 Antibody (NBP1-92005) (0)

There are no reviews for PEPT1/SLC15A1 Antibody (NBP1-92005). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for PEPT1/SLC15A1 Antibody (NBP1-92005) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PEPT1/SLC15A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC15A1