Orthogonal Strategies: Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Staining in human seminal vesicle and skeletal muscle tissues . Corresponding SLCO2A1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.
This antibody was developed against a recombinant protein corresponding to the amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMSSATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO2A1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%), Rat (81%).
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for SLCO2A1 Antibody - BSA Free
OATP2A1member 2
PGTmatrin F/G 1
Prostaglandin transporter
Solute carrier family 21 member 2
solute carrier organic anion transporter family member 2A1
solute carrier organic anion transporter family, member 2A1
Background
SLCO2A1 may mediate the release of newly synthesized prostaglandins from cells, the transepithelial transport of prostaglandins, and the clearance of prostaglandins from the circulation. Transports PGD2, as well as PGE1, PGE2 and PGF2A
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our SLCO2A1 Antibody - BSA Free and receive a gift card or discount.