SLCO2A1 Antibody

Images

 
Western Blot: SLCO2A1 Antibody [NBP2-13349] - Analysis in human cell line EFO-21.
Orthogonal Strategies: Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Staining in human seminal vesicle and skeletal muscle tissues. Corresponding SLCO2A1 RNA-seq data are presented for the same ...read more
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human prostate shows strong membranous positivity in endothelial cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human seminal vesicle shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human kidney shows strong membranous positivity in cells in glomeruli and endothelial cells.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human skeletal muscle shows no positivity as expected.
Immunohistochemistry-Paraffin: SLCO2A1 Antibody [NBP2-13349] - Immunohistochemical staining of human lung shows strong membranous positivity in endothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

SLCO2A1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PSTSSSIHPQSPACRRDCSCPDSIFHPVCGDNGIEYLSPCHAGCSNINMS SATSKQLIYLNCSCVTGGSASAKTGSCPVPCAH
Specificity
Specificity of human SLCO2A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLCO2A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLCO2A1 Protein (NBP2-13349PEP)
Publications
Read Publications using
NBP2-13349 in the following applications:

  • 1 publication
  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%), Rat (81%). Human reactivity reported in scientific literature (PMID: 26415544).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLCO2A1 Antibody

  • OATP2A1member 2
  • PGTmatrin F/G 1
  • Prostaglandin transporter
  • Solute carrier family 21 member 2
  • solute carrier organic anion transporter family member 2A1
  • solute carrier organic anion transporter family, member 2A1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-179
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-1471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-74482
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-59658
Species: Hu
Applications: WB
NBP1-85383
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001434-M08
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-59811
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-65352
Species: Hu
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP2-59438
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-65875
Species: Hu
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13349
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SLCO2A1 Antibody (NBP2-13349)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 3 applications: ICC/IF, IHC, WB.


Filter By Application
ICC/IF
(1)
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for SLCO2A1 Antibody (NBP2-13349) (0)

There are no reviews for SLCO2A1 Antibody (NBP2-13349). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLCO2A1 Antibody (NBP2-13349) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLCO2A1 Products

Bioinformatics Tool for SLCO2A1 Antibody (NBP2-13349)

Discover related pathways, diseases and genes to SLCO2A1 Antibody (NBP2-13349). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLCO2A1 Antibody (NBP2-13349)

Discover more about diseases related to SLCO2A1 Antibody (NBP2-13349).
 

Pathways for SLCO2A1 Antibody (NBP2-13349)

View related products by pathway.

PTMs for SLCO2A1 Antibody (NBP2-13349)

Learn more about PTMs related to SLCO2A1 Antibody (NBP2-13349).

Blogs on SLCO2A1

There are no specific blogs for SLCO2A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLCO2A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLCO2A1