SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

Immunocytochemistry/ Immunofluorescence: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Confocal imaging of paraffin-embedded Human liver cancer tissue using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Western Blot: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Western blot analysis of rat brain using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 5s.

Immunoprecipitation: SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) [SLC6A4/5-HTTLPR/Serotonin transporter] - Immunoprecipitation of SLC6A4/5-HTTLPR/Serotonin transporter from 500 ug extracts of HT-29 cells was performed using 2 ug of SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb . Rabbit IgG isotype control was used to precipitate the Control IgG sample. IP samples were eluted with 1X Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using SLC6A4/5-HTTLPR/Serotonin transporter Rabbit mAb at a dilution of 1:1000.

• Reactivity: Hu, Rt
• Applications: WB, ICC/IF
• Clone: 5T7M2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) Summary

• Description: Novus Biologicals Rabbit SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2) (NBP3-15668) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SLC6A4/5-HTTLPR/Serotonin transporter (NP_001036.1). METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTRHSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLG
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: SLC6A4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SLC6A4/5-HTTLPR/Serotonin transporter Antibody (5T7M2)

• 5HT transporter
• 5-HT Transporter
• 5-HTT
• 5HTTLPR
• 5-HTTLPR
• hSERT
• HTT5-hydroxytryptamine transporter
• Na+/Cl- dependent serotonin transporter
• OCD1
• Serotonin Transporter 1
• SERT
• SLC6A4
• sodium-dependent serotonin transporter
• solute carrier family 6 (neurotransmitter transporter, serotonin), member 4,5-HTTLPR
• Solute carrier family 6 member 4,5HTT

Background

Serotonin transporter encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein is a target of psychomotor stimulants, such as amphetamines and cocaine, and is a member of the sodium:neurotransmitter symporter family. A repeat length polymorphism in the promoter of this gene has been shown to affect the rate of serotonin uptake and may play a role in sudden infant death syndrome, aggressive behavior in Alzheimer disease patients, and depression-susceptibility in people experiencing emotional trauma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SLC6A4