![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining in human small intestine and liver tissues . Corresponding TPH1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0016.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining in human small intestine and liver tissues . Corresponding TPH1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TPH1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Serotonin N-acetyltransferase [p Thr29] Antibody - BSA Free](https://images.novusbio.com/images2/Serotonin-N-acetyltransferase-[p-Thr29]-Antibody-Western-Blot-NB120-3439-img0003.jpg)
| Images | Ratings | Applications | Species | Date | Details | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Hui Wang |
WB | Human | 08/19/2019 |
Summary
Comments
|
Secondary Antibodies |
Isotype Controls |
Diseases for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)Discover more about diseases related to Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922).
| Pathways for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)View related products by pathway.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TPH1 |
![Western Blot: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Human melanoma cell line A375 and 5 patient melanoma tissue samples. 15 ug cell lysate per lane. TPH1 antibody at 1:400, 4C O/N. WB image submitted by a verified customer review.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Western-Blot-NBP1-86922-img0020.jpg "Western Blot: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Human melanoma cell line A375 and 5 patient melanoma tissue samples. 15 ug cell lysate per lane. TPH1 antibody at 1:400, 4C O/N. WB image submitted by a verified customer review.")
![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0019.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0011.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0013.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0015.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Tryptophan-Hydroxylase-1-TPH-1-Antibody-Immunohistochemistry-Paraffin-NBP1-86922-img0018.jpg "Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Western_Blot_17092.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19241.jpg)
![Immunohistochemistry Dopa Decarboxylase/DDC Antibody [Unconjugated]](https://images.novusbio.com/images2/Dopa_Decarboxylase_AF3564_Immunohistochemistry_19242.jpg)
![BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Neutralization Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF682_Block_Neutralize_8947.jpg)
![Immunohistochemistry Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF682_Immunohistochemistry_19416.jpg)
![Western Blot Prolactin Antibody [Unconjugated]](https://images.novusbio.com/images2/Prolactin_AF682_Western_Blot_20170.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
