Tryptophan Hydroxylase 1/TPH-1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining in human small intestine and liver tissues . Corresponding TPH1 RNA-seq data are presented for ...read more
Western Blot: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Human melanoma cell line A375 and 5 patient melanoma tissue samples. 15 ug cell lysate per lane. TPH1 antibody at 1:400, 4C O/N. WB image submitted by ...read more
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human small intestine shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human duodenum shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Tryptophan Hydroxylase 1/TPH-1 Antibody [NBP1-86922] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Tryptophan Hydroxylase 1/TPH-1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ISELKHALSGHAKVKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSAMNELQHDLDVVSDALAKVSRKPSI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPH1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. TPH-1 antibody validated for WB from a verified customer review.
Control Peptide
Tryptophan Hydroxylase 1/TPH-1 Protein (NBP1-86922PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-86922 in the following applications:

Publications
Read Publication using NBP1-86922.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (85%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Tryptophan Hydroxylase 1/TPH-1 Antibody

  • EC 1.14.16
  • EC 1.14.16.4
  • indoleacetic acid-5-hydroxylase
  • L-tryptophan hydroxylase
  • MGC119994
  • TPH
  • TPH-1
  • TPRH
  • TRPH
  • tryptophan 5-hydroxylase 1
  • Tryptophan 5-monooxygenase 1
  • tryptophan hydroxylase (tryptophan 5-monooxygenase)
  • Tryptophan Hydroxylase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74555
Species: Hu, Mu, Pm, Rb, Rt
Applications: Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
H00006532-D01P
Species: Hu, Mu
Applications: WB
H00006999-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NBP2-38868
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-1780
Species: Hu, Mu
Applications: Flow, PEP-ELISA, WB
NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-Fr, Simple Western, WB
664-LI/CF
Species: Hu
Applications: BA
NB100-135
Species: Bv(-), Ch(-), Hu, Pm, Rt(-), Ze(-)
Applications: ICC/IF, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF3564
Species: Hu, Mu, Rt
Applications: ICC, IHC, IP, WB
NLS3921
Species: Hu, Pm, Pm
Applications: IHC, IHC-P
DBD00
Species: Hu
Applications: ELISA
MAB5764
Species: Hu
Applications: CyTOF-ready, Flow, IHC
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP2-43801
Species: Hu, Mu, Rt
Applications: WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-86922
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)(1)

Review for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-86922:
Filter by Applications
Western Blot
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Tryptophan Hydroxylase 1/TPH-1 NBP1-86922
Enlarge
5
reviewed by:
Verified Customer
Western Blot Human 08/19/2019
View

Summary

ApplicationWestern Blot
Sample Tested15 ug whole cell lysate
SpeciesHuman
LotF116659

Comments

CommentsCell lysate (1mg/ml), 15uL per lane.
Anti-TPH1 1:400 dilution, 4C overnight.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Tryptophan Hydroxylase 1/TPH-1 Products

Bioinformatics Tool for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)

Discover related pathways, diseases and genes to Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)

Discover more about diseases related to Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922).
 

Pathways for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)

View related products by pathway.

PTMs for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)

Learn more about PTMs related to Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922).
 

Research Areas for Tryptophan Hydroxylase 1/TPH-1 Antibody (NBP1-86922)

Find related products by research area.

Blogs on Tryptophan Hydroxylase 1/TPH-1

There are no specific blogs for Tryptophan Hydroxylase 1/TPH-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
08/19/2019
Application: Western Blot
Species: Human

Bioinformatics

Gene Symbol TPH1