SLC43A3 Antibody

Images

 
Western Blot: SLC43A3 Antibody [NBP1-69535] - This Anti-SLC43A3 antibody was used in Western Blot of Jurkat tissue lysate at a concentration of 2.5ug/ml.
Immunohistochemistry: SLC43A3 Antibody [NBP1-69535] - Staining of human Lung.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC43A3 Antibody Summary

Immunogen
Synthetic peptides corresponding to SLC43A3(solute carrier family 43, member 3) The peptide sequence was selected from the N terminal of SLC43A3. Peptide sequence MAGQGLPLHVATLLTGLLECLGFAGVLFGWPSLVFVFKNEDYFKDLCGPD.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC43A3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for SLC43A3 Antibody

  • DKFZp762A227
  • Eeg1
  • FOAP-13
  • likely ortholog of mouse embryonic epithelial gene 1
  • PRO1659
  • Protein FOAP-13
  • SEEEG-1
  • solute carrier family 43 member 3
  • solute carrier family 43, member 3

Background

SLC43A3 belongs to the SLC43A transporter family and is a putative transporter.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87331
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
H00054922-B01P
Species: Hu, Mu
Applications: WB, ELISA
NB100-2450
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-91547
Species: Hu
Applications: WB
NBP1-59904
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01853
Species: Hu, Mk
Applications: WB, Flow, IHC, IHC-P
H00055885-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-87011
Species: Hu
Applications: WB, IP
AF340
Species: Hu
Applications: WB, IHC, Block
NBP2-43581
Species: Hu
Applications: WB, ICC/IF, IP
NBP1-78446
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF7970
Species: Mu
Applications: WB
NB100-56106
Species: Hu, Mu, Rt, Ca, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-32491
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32550
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
366-6C/CF
Species: Hu

Publications for SLC43A3 Antibody (NBP1-69535) (0)

There are no publications for SLC43A3 Antibody (NBP1-69535).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC43A3 Antibody (NBP1-69535) (0)

There are no reviews for SLC43A3 Antibody (NBP1-69535). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC43A3 Antibody (NBP1-69535) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SLC43A3 Products

Bioinformatics Tool for SLC43A3 Antibody (NBP1-69535)

Discover related pathways, diseases and genes to SLC43A3 Antibody (NBP1-69535). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC43A3 Antibody (NBP1-69535)

Discover more about diseases related to SLC43A3 Antibody (NBP1-69535).
 

Pathways for SLC43A3 Antibody (NBP1-69535)

View related products by pathway.

Blogs on SLC43A3

There are no specific blogs for SLC43A3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC43A3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC43A3
Uniprot