Orthogonal Strategies: Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining in human stomach and liver tissues using NBP2-39021 antibody. Corresponding GALNT7 ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney, liver, prostate and stomach using Anti-GALNT7 antibody NBP2-39021 ...read more
Western Blot: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human cell line HaCaT shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human kidney shows very weak positivity in cells in tubules as expected.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human prostate shows strong positivity in glandular cells of Golgi apparatus.
Immunohistochemistry-Paraffin: Polypeptide GalNac Transferase 7/GALNT7 Antibody [NBP2-39021] - Staining of human stomach shows strong positivity in Golgi apparatus in glandular cells.
Novus Biologicals Rabbit Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free (NBP2-39021) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Polypeptide GalNac Transferase 7/GALNT7 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GDSQKDIMQRQYLTFKPQTFTYHDPVLRPGILGNFEPKEPEPPGVVGGPGEKAKPLVLGPEFKRAI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GALNT7
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Use in Mouse reported in scientific literature (PMID:35087510). Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
GALNT7 encodes GalNAc transferase 7, a member of the GalNAc-transferase family. The enzyme encoded by this gene controls the initiation step of mucin-type O-linked protein glycosylation and transfer of N-acetylgalactosamine to serine and threonine amino acid residues. This enzyme is a type II transmembrane protein and shares common sequence motifs with other family members. Unlike other family members, this enzyme shows exclusive specificity for partially GalNAc-glycosylated acceptor substrates and shows no activity with non-glycosylated peptides. This protein may function as a follow-up enzyme in the initiation step of O-glycosylation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39021) (0)
There are no reviews for Polypeptide GalNac Transferase 7/GALNT7 Antibody (NBP2-39021).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Polypeptide GalNac Transferase 7/GALNT7 Antibody - BSA Free and receive a gift card or discount.