LAT3 Antibody - BSA Free

Immunohistochemistry-Paraffin: LAT3 Antibody [NBP1-87332] - Analysis in human pancreas and cerebral cortex tissues. Corresponding RNA-seq data are presented for the same tissues.

Immunocytochemistry/Immunofluorescence: LAT3 Antibody [NBP1-87332] - Staining of human cell line A-431 shows localization to plasma membrane & vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: LAT3 Antibody [NBP1-87332] - Staining of human pancreas shows strong membranous positivity in exocrine glandular cells.

Immunohistochemistry-Paraffin: LAT3 Antibody [NBP1-87332] - Staining of human skin shows strong membranous positivity in keratinocytes.

Immunohistochemistry-Paraffin: LAT3 Antibody [NBP1-87332] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: LAT3 Antibody [NBP1-87332] - Staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons

• Reactivity: Hu
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

LAT3 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SLC43A1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  LAT3 Protein (NBP1-87332PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for LAT3 Antibody - BSA Free

• LAT3prostate cancer overexpressed gene 1
• PB39L-type amino acid transporter 3
• POV1large neutral amino acids transporter small subunit 3
• Prostate cancer overexpressed gene 1 protein
• R00504
• Solute carrier family 43 member 1
• solute carrier family 43, member 1

Background

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for LAT3 Antibody (NBP1-87332)(1)

Publication using NBP1-87332

• Selenge B, Yamada S, Morine Y et al. Impact of L-type amino acid transporter 3 on the prognosis of hepatocellular carcinoma Oncology letters 2022-11-01 [PMID: 36245821] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: SLC43A1