Recombinant Human SLC3A1 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human SLC3A1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 211-320 of Human SLC3A1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FIPNHTSDKHIWFQLSRTRTGKYTDYYIWHDCTHENGKTIPPNNWLSVYGNSSWHFDEVRNQCYFHQFMKEQPDLNFRNPDVQEEIKEILRFWLTKGVDGFSLDAVKFLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC3A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.73 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SLC3A1 GST (N-Term) Protein

  • activator of cystine, dibasic and neutral amino acid transport), member 1
  • amino acid transporter 1
  • ATR1SLC3A1 variant C
  • B(0+)-type amino acid transport protein
  • CSNU1
  • D2h
  • D2HSLC3A1 variant D
  • dibasic and neutral amino acid transporters)
  • FLJ34681
  • member 1
  • NBATneutral and basic amino acid transport protein rBAT
  • RBATSLC3A1 variant B
  • SLC3A1 variant E
  • SLC3A1 variant F
  • SLC3A1 variant G
  • solute carrier family 3 (cystine, dibasic and neutral amino acid transporters

Background

SLC3A1 - solute carrier family 3 (cystine, dibasic and neutral amino acid transporters, activator of cystine, dibasic and neutral amino acid transport), member 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93638
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-30027
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF1513
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
NBP2-80662
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P, WB
NBP2-50465
Species: Hu
Applications: CyTOF-ready, Flow-CS, Flow, IHC, IHC-P
NBP1-89200
Species: Hu, Mu
Applications: IHC, IHC-P, Simple Western, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-83077
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NBP2-93305
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, WB
NBP2-75476
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89296
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-00178
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
NB300-500
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC, IHC-P, WB
NB300-581
Species: Am, Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00006519-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for SLC3A1 Partial Recombinant Protein (H00006519-Q01) (0)

There are no publications for SLC3A1 Partial Recombinant Protein (H00006519-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC3A1 Partial Recombinant Protein (H00006519-Q01) (0)

There are no reviews for SLC3A1 Partial Recombinant Protein (H00006519-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SLC3A1 Partial Recombinant Protein (H00006519-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SLC3A1 Products

Bioinformatics Tool for SLC3A1 Partial Recombinant Protein (H00006519-Q01)

Discover related pathways, diseases and genes to SLC3A1 Partial Recombinant Protein (H00006519-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC3A1 Partial Recombinant Protein (H00006519-Q01)

Discover more about diseases related to SLC3A1 Partial Recombinant Protein (H00006519-Q01).
 

Pathways for SLC3A1 Partial Recombinant Protein (H00006519-Q01)

View related products by pathway.

PTMs for SLC3A1 Partial Recombinant Protein (H00006519-Q01)

Learn more about PTMs related to SLC3A1 Partial Recombinant Protein (H00006519-Q01).
 

Research Areas for SLC3A1 Partial Recombinant Protein (H00006519-Q01)

Find related products by research area.

Blogs on SLC3A1

There are no specific blogs for SLC3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human SLC3A1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC3A1