Reactivity | Hu, Mu, RtSpecies Glossary |
Applications | WB, ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human SLC7A9 (NP_055085.1). MGDTGLRKRREDEKSIQSQEPKTTSLQKELGLISGISIIVGTIIGSGIFVSPKSVLSNTEAVGPCLIIWAACGVLATLGALCFAELGTMITKSGGEYPYL |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC7A9 |
Purity | Affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Theoretical MW | 53 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Storage | Store at -20C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.3), 50% glycerol |
Preservative | 0.01% Thimerosal |
Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC7A9 Antibody (NBP2-93638)Discover more about diseases related to SLC7A9 Antibody (NBP2-93638).
| Pathways for SLC7A9 Antibody (NBP2-93638)View related products by pathway.
|
PTMs for SLC7A9 Antibody (NBP2-93638)Learn more about PTMs related to SLC7A9 Antibody (NBP2-93638).
| Research Areas for SLC7A9 Antibody (NBP2-93638)Find related products by research area.
|
The effects of ethanol consumption on glutamate production and xCT xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SLC7A9 |