![Western Blot: Prolyl endopeptidase-like Antibody [NBP2-93305] - Analysis of extracts of various cell lines, using Prolyl endopeptidase-like at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.](http://images.novusbio.com/fullsize/Prolyl-endopeptidase-like-Antibody-Western-Blot-NBP2-93305-img0003.jpg "Western Blot: Prolyl endopeptidase-like Antibody [NBP2-93305] - Analysis of extracts of various cell lines, using Prolyl endopeptidase-like at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 578-727 of human PREPL (NP_006027.2). AVTLEAPFLDVLNTMMDTTLPLTLEELEEWGNPSSDEKHKNYIKRYCPYQNIKPQHYPSIHITAYENDERVPLKGIVSYTEKLKEAIAEHAKDTGEGYQTPNIILDIQPGGNHVIEDSHKKITAQIKFLYEELGLDSTSVFEDLKKYLKF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PREPL |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Prolyl endopeptidase-like Antibody (NBP2-93305)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PREPL |
![Immunocytochemistry/Immunofluorescence: Prolyl endopeptidase-like Antibody [NBP2-93305] - Analysis of C6 cells using Prolyl endopeptidase-like . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/Prolyl-endopeptidase-like-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-93305-img0001.jpg "Immunocytochemistry/Immunofluorescence: Prolyl endopeptidase-like Antibody [NBP2-93305] - Analysis of C6 cells using Prolyl endopeptidase-like . Blue: DAPI for nuclear staining.")
![Immunocytochemistry/ Immunofluorescence: Prolyl endopeptidase-like Antibody - Azide and BSA Free [NBP2-93305] - Immunofluorescence analysis of L929 cells using Prolyl endopeptidase-like Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-93305_rabbit-polyclonal-prolyl-endopeptidase-like-antibody-422025142900.jpg%3Ft=1709114016 "Immunocytochemistry/ Immunofluorescence: Prolyl endopeptidase-like Antibody - Azide and BSA Free [NBP2-93305] - Immunofluorescence analysis of L929 cells using Prolyl endopeptidase-like Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.")
![Western Blot Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Western_Blot_20961.jpg)
![ELISA Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_ELISA_22201.jpg)
![Neutralization Growth Hormone Antibody [Unconjugated]](https://images.novusbio.com/images2/Growth_Hormone_AF1067_Block_Neutralize_8751.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")