SLC38A2 Antibody

Images

 
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human kidney shows moderate cytoplasmic granular positivity in cells in tubules.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: SLC38A2 Antibody [NBP1-88872] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MKKAEMGRFSISPDEDSSSYSSNSDFNYSYPTKQAALKSHYADVDPENQNFLLESNLGKKKYETEFHP
Specificity
Specificity of human SLC38A2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
SLC38A2 Recombinant Protein Antigen (NBP1-88872PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A2 Antibody

  • Amino acid transporter A2
  • ata2
  • ATA2System A transporter 1
  • KIAA1382System N amino acid transporter 2
  • pro1068
  • Protein 40-9-1
  • sat2
  • SAT2PRO1068
  • snat2
  • SNAT2amino acid transporter 2
  • sodium-coupled neutral amino acid transporter 2
  • Solute carrier family 38 member 2
  • solute carrier family 38, member 2
  • System A amino acid transporter 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB110-41622
Species: Hu, Mu, Rt, Po, Bv, Ch, Gt, Xp
Applications: WB, IHC, IHC-P
NBP1-55228
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50465
Species: Hu
Applications: Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
NBP1-84897
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89327
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC, IHC-P, IP, Flow-CS
NB110-39113
Species: Hu, Mu, Rt, Rb
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Flow-IC
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
AF4066
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for SLC38A2 Antibody (NBP1-88872) (0)

There are no publications for SLC38A2 Antibody (NBP1-88872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A2 Antibody (NBP1-88872) (0)

There are no reviews for SLC38A2 Antibody (NBP1-88872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for SLC38A2 Antibody (NBP1-88872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SLC38A2 Products

Bioinformatics Tool for SLC38A2 Antibody (NBP1-88872)

Discover related pathways, diseases and genes to SLC38A2 Antibody (NBP1-88872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC38A2 Antibody (NBP1-88872)

Discover more about diseases related to SLC38A2 Antibody (NBP1-88872).
 

Pathways for SLC38A2 Antibody (NBP1-88872)

View related products by pathway.

PTMs for SLC38A2 Antibody (NBP1-88872)

Learn more about PTMs related to SLC38A2 Antibody (NBP1-88872).

Blogs on SLC38A2

There are no specific blogs for SLC38A2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A2