SLC38A5 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SLC38A5 Antibody [NBP1-92402] - Immunofluorescent staining of human cell line HeLa shows localization to plasma membrane, cytosol & vesicles. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC38A5 Antibody [NBP1-92402] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SLC38A5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFE
Specificity
Specificity of human SLC38A5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC38A5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SLC38A5 Protein (NBP1-92402PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SLC38A5 Antibody

  • SN2JM24pp7194
  • SNAT5
  • sodium-coupled neutral amino acid transporter 5
  • Solute carrier family 38 member 5
  • solute carrier family 38, member 5
  • System N transporter 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-60103
Species: Hu
Applications: WB, IHC
NBP2-13336
Species: Hu
Applications: IHC, IHC-P
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA
NBP2-15895
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-47989
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NB100-135
Species: Hu, Pm, Bv(-), Ch(-), Rt(-), Ze(-)
Applications: WB, ICC/IF
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-50465
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Flow-CS
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB1936
Species: Hu
Applications: WB, IP
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00289
Species: Hu
Applications: WB, Flow, IHC-P, IP, Flow-CS
NBP1-92402
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for SLC38A5 Antibody (NBP1-92402) (0)

There are no publications for SLC38A5 Antibody (NBP1-92402).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SLC38A5 Antibody (NBP1-92402) (0)

There are no reviews for SLC38A5 Antibody (NBP1-92402). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC38A5 Antibody (NBP1-92402) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SLC38A5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC38A5