Reactivity | Hu, RtSpecies Glossary |
Applications | ICC/IF, IHC |
Clonality | Polyclonal |
Host | Rabbit |
Conjugate | Unconjugated |
Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP |
Isotype | IgG |
Clonality | Polyclonal |
Host | Rabbit |
Gene | SLC26A1 |
Purity | Immunogen affinity purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
||
Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
Control Peptide |
|
||
Publications |
|
Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.2) and 40% Glycerol |
Preservative | 0.02% Sodium Azide |
Purity | Immunogen affinity purified |
Publication using NBP1-84897 | Applications | Species |
---|---|---|
Gee HY, Jun I, Braun DA et al. Mutations in SLC26A1 Cause Nephrolithiasis. Am. J. Hum. Genet. 2016-06-02 [PMID: 27210743] (ICC/IF, Human) | ICC/IF | Human |
Secondary Antibodies |
Isotype Controls |
Diseases for SLC26A1 Antibody (NBP1-84897)Discover more about diseases related to SLC26A1 Antibody (NBP1-84897).
| Pathways for SLC26A1 Antibody (NBP1-84897)View related products by pathway.
|
PTMs for SLC26A1 Antibody (NBP1-84897)Learn more about PTMs related to SLC26A1 Antibody (NBP1-84897).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | SLC26A1 |