SLC26A1 Antibody


Immunocytochemistry/ Immunofluorescence: SLC26A1 Antibody [NBP1-84897] - Staining of human cell line Hep G2 shows localization to microtubules. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: SLC26A1 Antibody [NBP1-84897] - Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Product Details

Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SLC26A1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
Specificity of human SLC26A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. Use in ICC/IF reported in scientific literature (PMID 27210743).
Control Peptide
Read Publication using
NBP1-84897 in the following applications:

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 27210743).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SLC26A1 Antibody

  • EDM4
  • SAT1
  • SAT-1sulfate anion transporter 1
  • solute carrier family 26 (sulfate transporter), member 1
  • Solute carrier family 26 member 1
  • sulfate anion tranporter AT1
  • sulfate transporter
  • sulfate/anion transporter SAT-1 protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, GP, Rb, Sh
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Bv, Eq, GP, Rb
Applications: WB, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC-P, PLA
Species: Hu
Applications: IHC, IHC-P

Publications for SLC26A1 Antibody (NBP1-84897)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: ICC/IF.

Filter By Application
All Applications
Filter By Species
All Species
Showing Publication 1 - 1 of 1.
Publication using NBP1-84897 Applications Species
Gee HY, Jun I, Braun DA et al. Mutations in SLC26A1 Cause Nephrolithiasis. Am. J. Hum. Genet. Jun 2 2016 [PMID: 27210743] (ICC/IF, Human) ICC/IF Human

Reviews for SLC26A1 Antibody (NBP1-84897) (0)

There are no reviews for SLC26A1 Antibody (NBP1-84897). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SLC26A1 Antibody (NBP1-84897) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional SLC26A1 Products

Bioinformatics Tool for SLC26A1 Antibody (NBP1-84897)

Discover related pathways, diseases and genes to SLC26A1 Antibody (NBP1-84897). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SLC26A1 Antibody (NBP1-84897)

Discover more about diseases related to SLC26A1 Antibody (NBP1-84897).

Pathways for SLC26A1 Antibody (NBP1-84897)

View related products by pathway.

PTMs for SLC26A1 Antibody (NBP1-84897)

Learn more about PTMs related to SLC26A1 Antibody (NBP1-84897).

Blogs on SLC26A1

There are no specific blogs for SLC26A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SLC26A1 Antibody and receive a gift card or discount.


Gene Symbol SLC26A1